BDKRB2 Antikörper (AA 357-391)

Produktnummer ABIN5647061

Der Kaninchen Polyklonal anti-BDKRB2 Antikörper (ABIN5647061) detektiert spezifisch BDKRB2 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus und Ratte.

Kurzübersicht für BDKRB2 Antikörper (AA 357-391) (ABIN5647061)

Target: BDKRB2 (Bradykinin Receptor B2 (BDKRB2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser BDKRB2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-BDKRB2 Antikörper

Bindungsspezifität: AA 357-391

Verwendungszweck: BDKRB2 Antibody / B2 bradykinin receptor

Sequenz: RSEPIQMENS MGTLRTSISV ERQIHKLQDW AGSRQ

Aufreinigung: Antigen affinity

Immunogen: Amino acids 357-391 (RSEPIQMENSMGTLRTSISVERQIHKLQDWAGSRQ) from the human protein were used as the immunogen for the BDKRB2 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Differences in protocols and secondary/substrate sensitivity may require the BDKRB2 antibody to be titrated for optimal performance.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the BDKRB2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu BDKRB2

Target: BDKRB2 (Bradykinin Receptor B2 (BDKRB2))

Andere Bezeichnung: BDKRB2

Hintergrund: Bradykinin receptor B2 is a G-protein coupled receptor forbradykinin, encoded by the BDKRB2 gene in humans. This gene encodes a receptor for bradykinin. The 9 aa bradykinin peptide elicits many responses including vasodilation, edema, smooth muscle spasm and pain fiber stimulation. This receptor associates with G proteins that stimulate a phosphatidylinositol-calcium second messenger system. Alternate start codons result in two isoforms of the protein.

UniProt: P30411

Pathways: ACE Inhibitor Pathway, Negative Regulation of intrinsic apoptotic Signaling