BDKRB2 Antikörper (AA 357-391)
-
- Target Alle BDKRB2 Antikörper anzeigen
- BDKRB2 (Bradykinin Receptor B2 (BDKRB2))
-
Bindungsspezifität
- AA 357-391
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser BDKRB2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Antigen affinity purified
- Immunogen
- Amino acids 357-391 (RSEPIQMENSMGTLRTSISVERQIHKLQDWAGSRQ) from the human protein were used as the immunogen for the BDKRB2 antibody.
- Isotyp
- IgG
- Top Product
- Discover our top product BDKRB2 Primärantikörper
-
-
- Applikationshinweise
- Western blot: 0.5-1 μg/mL
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Lagerung
- -20 °C
- Informationen zur Lagerung
- After reconstitution, the BDKRB2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Target
- BDKRB2 (Bradykinin Receptor B2 (BDKRB2))
- Andere Bezeichnung
- BDKRB2 (BDKRB2 Produkte)
- Hintergrund
- Bradykinin receptor B2 is a G-protein coupled receptor forbradykinin, encoded by the BDKRB2 gene in humans. This gene encodes a receptor for bradykinin. The 9 aa bradykinin peptide elicits many responses including vasodilation, edema, smooth muscle spasm and pain fiber stimulation. This receptor associates with G proteins that stimulate a phosphatidylinositol-calcium second messenger system. Alternate start codons result in two isoforms of the protein.
- UniProt
- P30411
- Pathways
- ACE Inhibitor Pathway, Negative Regulation of intrinsic apoptotic Signaling
-