Annexin VIII Antikörper (AA 20-61)

Produktnummer ABIN5647020

Produktdetails anti-Annexin VIII Antikörper

Target: Annexin VIII (ANXA8) (Annexin A8 (ANXA8))

Bindungsspezifität: AA 20-61

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Annexin VIII Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 20-61 (HFNPDPDAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQIAK) from the human protein were used as the immunogen for the Annexin VIII antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the Annexin VIII antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the Annexin VIII antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu Annexin VIII

Target: Annexin VIII (ANXA8) (Annexin A8 (ANXA8))

Andere Bezeichnung: Annexin VIII (ANXA8 Produkte)

Synonyme: ANX8 antikoerper, ANXA8L1 antikoerper, ANXA8L2 antikoerper, AI466995 antikoerper, Anx8 antikoerper, anx8 antikoerper, MGC85309 antikoerper, ANXA8 antikoerper, annexin A8 antikoerper, annexin A8 S homeolog antikoerper, ANXA8 antikoerper, Anxa8 antikoerper, anxa8.S antikoerper, LOC694628 antikoerper, LOC100052045 antikoerper

Hintergrund: ANXA8 is also known as Annexin VIII. This gene encodes a member of the annexin family of evolutionarily conserved Ca2+ and phospholipid binding proteins. The encoded protein may function as an anticoagulant that indirectly inhibits the thromboplastin-specific complex. Overexpression of this gene has been associated with acute myelocytic leukemia. A highly similar duplicated copy of this gene is found in close proximity on the long arm of chromosome 10.

UniProt: P13928