ALDH1B1 Antikörper (AA 116-156)

Produktnummer ABIN5647015

Produktdetails anti-ALDH1B1 Antikörper

Target: ALDH1B1 (Aldehyde Dehydrogenase 1 Family, Member B1 (ALDH1B1))

Bindungsspezifität: AA 116-156

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ALDH1B1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 116-156 (RVYLASLETLDNGKPFQESYALDLDEVIKVYRYFAGWADKW from the human protein were used as the immunogen for the ALDH1B1 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Western blot: 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the ALDH1B1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu ALDH1B1

Target: ALDH1B1 (Aldehyde Dehydrogenase 1 Family, Member B1 (ALDH1B1))

Andere Bezeichnung: ALDH1B1 (ALDH1B1 Produkte)

Hintergrund: Aldehyde dehydrogenase X, mitochondrial is an enzyme that in humans is encoded by the ALDH1B1 gene. This protein belongs to the aldehyde dehydrogenases family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. This gene does not contain introns in the coding sequence. The variation of this locus may affect the development of alcohol-related problems.

UniProt: P30837