Adenylate Kinase 1 Antikörper (AA 149-189)

Produktnummer ABIN5647008

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch Adenylate Kinase 1 in WB, FACS und IHC (p). Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für Adenylate Kinase 1 Antikörper (AA 149-189) (ABIN5647008)

Target: Adenylate Kinase 1 (AK1)

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Adenylate Kinase 1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Produktdetails anti-Adenylate Kinase 1 Antikörper

Bindungsspezifität: AA 149-189

Verwendungszweck: AK1 Antibody / Adenylate Kinase 1

Sequenz: RLETYYKATE PVIAFYEKRG IVRKVNAEGS VDSVFSQVCT H

Aufreinigung: Antigen affinity

Immunogen: Amino acids 149-189 (RLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTH) from the human protein were used as the immunogen for the AK1 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Differences in protocols and secondary/substrate sensitivity may require the AK1 antibody to be titrated for optimal performance.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the AK1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu Adenylate Kinase 1

Target: Adenylate Kinase 1 (AK1)

Andere Bezeichnung: AK1

Hintergrund: This gene encodes an adenylate kinase enzyme involved in energy metabolism and homeostasis of cellular adenine nucleotide ratios in different intracellular compartments. This gene is highly expressed in skeletal muscle, brain and erythrocytes. Certain mutations in this gene resulting in a functionally inadequate enzyme are associated with a rare genetic disorder causing nonspherocytic hemolytic anemia. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms.

UniProt: P00568

Pathways: Nucleotide Phosphorylation, Ribonucleoside Biosynthetic Process