DAO Antikörper (AA 144-180)

Produktnummer ABIN5646959

Der Kaninchen Polyklonal anti-DAO Antikörper (ABIN5646959) detektiert spezifisch DAO in WB, IF und IHC (p). Dieser Antikörper reagiert spezifisch mit Proben aus Human und Affe.

Kurzübersicht für DAO Antikörper (AA 144-180) (ABIN5646959)

Target: DAO (ABP1) (Amiloride Binding Protein 1 (Amine Oxidase (Copper-Containing)) (ABP1))

Reaktivität: Human, Affe

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DAO Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Produktdetails anti-DAO Antikörper

Bindungsspezifität: AA 144-180

Verwendungszweck: ABP1 Antibody / AOC1 / Amiloride binding protein 1

Sequenz: STAEYALLYH TLQEATKPLH QFFLNTTGFS FQDCHDR

Aufreinigung: Antigen affinity

Immunogen: Amino acids 144-180 (STAEYALLYHTLQEATKPLHQFFLNTTGFSFQDCHDR) from the human protein were used as the immunogen for the ABP1 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Differences in protocols and secondary/substrate sensitivity may require the ABP1 antibody to be titrated for optimal performance.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the ABP1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu DAO

Target: DAO (ABP1) (Amiloride Binding Protein 1 (Amine Oxidase (Copper-Containing)) (ABP1))

Andere Bezeichnung: ABP1

Hintergrund: The AOC1 gene encodes a metal-binding membrane glycoprotein that oxidatively deaminates putrescine, histamine, and related compounds. The encoded protein is inhibited by amiloride, a diuretic that acts by closing epithelial sodium ion channels. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. Catalyzes the degradation of compounds such as putrescine, histamine, spermine, and spermidine, substances involved in allergic and immune responses, cell proliferation, tissue differentiation, tumor formation, and possibly apoptosis. Placental DAO is thought to play a role in the regulation of the female reproductive function.

UniProt: P19801