DAO Antikörper (AA 144-180)

Produktnummer ABIN5646959

Dieses Anti-DAO-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von DAO in WB. Geeignet für Human und Ratte.

Kurzübersicht für DAO Antikörper (AA 144-180) (ABIN5646959)

Target: DAO (ABP1) (Amiloride Binding Protein 1 (Amine Oxidase (Copper-Containing)) (ABP1))

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DAO Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DAO Antikörper

Bindungsspezifität: AA 144-180

Aufreinigung: Antigen affinity purified

Immunogen: Amino acids 144-180 (STAEYALLYHTLQEATKPLHQFFLNTTGFSFQDCHDR) from the human protein were used as the immunogen for the ABP1 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Western blot: 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the ABP1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu DAO

Target: DAO (ABP1) (Amiloride Binding Protein 1 (Amine Oxidase (Copper-Containing)) (ABP1))

Andere Bezeichnung: ABP1 / Amiloride binding protein 1

Hintergrund: The AOC1 encodes a metal-binding membrane glycoprotein that oxidatively deaminates putrescine, histamine, and related compounds. The encoded protein is inhibited by amiloride, a diuretic that acts by closing epithelial sodium ion channels. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. Catalyzes the degradation of compounds such as putrescine, histamine, spermine, and spermidine, substances involved in allergic and immune responses, cell proliferation, tissue differentiation, tumor formation, and possibly apoptosis. Placental DAO is thought to play a role in the regulation of the female reproductive function.

UniProt: P19801