CDC20 Antikörper

Produktnummer ABIN5518976

Produktdetails anti-CDC20 Antikörper

Target: CDC20 (Cell Division Cycle 20 Homolog (S. Cerevisiae) (CDC20))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CDC20 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Cdc20 detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequenz: QTPTKKEHQK AWALNLNGFD VEEAKILRLS GKPQNAPEGY QNRLKVLYSQ KAT

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Cdc20 detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: cell division cycle 20
Protein Name: Cell division cycle protein 20 homolog

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence of human Cdc20 (QTPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKAT).

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu CDC20

Target: CDC20 (Cell Division Cycle 20 Homolog (S. Cerevisiae) (CDC20))

Andere Bezeichnung: CDC20 (CDC20 Produkte)

Synonyme: X-FZY antikoerper, ba276h19.3 antikoerper, cdc20a antikoerper, fizzy1 antikoerper, p55cdc antikoerper, CDC20A antikoerper, bA276H19.3 antikoerper, p55CDC antikoerper, 2310042N09Rik antikoerper, C87100 antikoerper, cell division cycle 20 antikoerper, cell division cycle 20 L homeolog antikoerper, cell division cycle 20 homolog (S. cerevisiae) antikoerper, cdc20 antikoerper, CDC20 antikoerper, cdc20.L antikoerper, Cdc20 antikoerper

Hintergrund: The cell-division cycle protein 20, also known as p55CDC, is an essential regulator of cell division that is encoded by the CDC20 gene in humans. The chromosomal assignment of human CDC20 is 1p34.2. CDC20 is a component of the mammalian cell cycle mechanism. CDC20 appears to act as a regulatory protein interacting with many other proteins at multiple points in the cell cycle. This gene's most important function is to activate the anaphase promoting complex (APC), a large 11-13 subunit complex that initiates chromatid separation and entrance into anaphase.

Synonyms: Cell division cycle protein 20 homolog, p55CDC, CDC20

Gen-ID: 991

UniProt: Q12834