XPO5 Antikörper (N-Term)

Produktnummer ABIN5518968

Produktdetails anti-XPO5 Antikörper

Target: XPO5 (Exportin 5 (XPO5))

Bindungsspezifität: AA 2-43, N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser XPO5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Exportin-5(XPO5) detection. Tested with WB in Human,Mouse,Rat.

Sequenz: AMDQVNALCE QLVKAVTVMM DPNSTQRYRL EALKFCEEFK EK

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Exportin-5(XPO5) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: exportin 5
Protein Name: Exportin-5

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Exportin-5 (2-43aa AMDQVNALCEQLVKAVTVMMDPNSTQRYRLEALKFCEEFKEK), different from the related mouse sequence by four amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu XPO5

Target: XPO5 (Exportin 5 (XPO5))

Andere Bezeichnung: XPO5 (XPO5 Produkte)

Synonyme: exp5 antikoerper, CG12234 antikoerper, Dmel\\CG12234 antikoerper, Exp-5 antikoerper, Exp5 antikoerper, RanBP21 antikoerper, dmExp5 antikoerper, 2410004H11Rik antikoerper, 2700038C24Rik antikoerper, AI648907 antikoerper, AW549301 antikoerper, RanBp21 antikoerper, mKIAA1291 antikoerper, exportin-5 antikoerper, ranbp21 antikoerper, DDBDRAFT_0185980 antikoerper, DDBDRAFT_0237583 antikoerper, DDB_0185980 antikoerper, DDB_0237583 antikoerper, XPO5 antikoerper, exportin 5 antikoerper, CG12234 gene product from transcript CG12234-RB antikoerper, armadillo-like helical domain-containing protein antikoerper, XPO5 antikoerper, Ranbp21 antikoerper, Xpo5 antikoerper, xpo5 antikoerper

Hintergrund: Exportin-5 (XPO5) is a protein that in humans is encoded by the XPO5 gene. The International Radiation Hybrid Mapping Consortium mapped the XPO5 gene to chromosome 6. This gene encodes a member of the karyopherin family that is required for the transport of small RNAs and double-stranded RNA-binding proteins from the nucleus to the cytoplasm. The encoded protein translocates cargo through the nuclear pore complex in a RanGTP-dependent process.

Synonyms: Exportin-5, Exp5, Ran-binding protein 21, XPO5, KIAA1291, RANBP21

Gen-ID: 57510

Pathways: Regulatorische RNA Pathways, Protein targeting to Nucleus