MAK Antikörper (C-Term)
-
- Target Alle MAK Antikörper anzeigen
- MAK (Male Germ Cell-Associated Kinase (MAK))
-
Bindungsspezifität
- AA 588-623, C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MAK Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Serine/threonine-protein kinase MAK(MAK) detection. Tested with WB in Human.
- Sequenz
- RTYNPTAKNL NIVNRAQPIP SVHGRTDWVA KYGGHR
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Serine/threonine-protein kinase MAK(MAK) detection. Tested with WB in Human.
Gene Name: male germ cell associated kinase
Protein Name: Serine/threonine-protein kinase MAK - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human MAK (588-623aa RTYNPTAKNLNIVNRAQPIPSVHGRTDWVAKYGGHR), different from the related mouse and rat sequences by two amino acids.
- Isotyp
- IgG
- Top Product
- Discover our top product MAK Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Lagerung
- 4 °C,-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- MAK (Male Germ Cell-Associated Kinase (MAK))
- Andere Bezeichnung
- MAK (MAK Produkte)
- Synonyme
- RP62 antikoerper, dJ417M14.2 antikoerper, A930010O05Rik antikoerper, Ick antikoerper, fj04c02 antikoerper, wu:fj04c02 antikoerper, zgc:56603 antikoerper, rp62 antikoerper, xmak antikoerper, MGC82717 antikoerper, MGC146434 antikoerper, male germ cell associated kinase antikoerper, male germ cell-associated kinase antikoerper, male germ cell associated kinase L homeolog antikoerper, MAK antikoerper, Mak antikoerper, mak antikoerper, mak.L antikoerper
- Hintergrund
-
Serine/threonine-protein kinase MAK is an enzyme that in humans is encoded by the MAK gene. The product of this gene is a serine/threonine protein kinase related to kinases involved in cell cycle regulation. Studies of the mouse and rat homologs have localized the kinase to the chromosomes during meiosis in spermatogenesis, specifically to the synaptonemal complex that exists while homologous chromosomes are paired. Mutations in this gene have been associated with ciliary defects resulting in retinitis pigmentosa 62.
Synonyms: Serine/threonine-protein kinase MAK - Gen-ID
- 4117
- UniProt
- P20794
-