HOXB1 Antikörper (C-Term)

Produktnummer ABIN5518919

Produktdetails anti-HOXB1 Antikörper

Target: HOXB1 (Homeobox B1 (HOXB1))

Bindungsspezifität: AA 176-220, C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HOXB1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Homeobox protein Hox-B1(HOXB1) detection. Tested with WB in Human,Mouse,Rat.

Sequenz: TARTFDWMKV KRNPPKTAKV SEPGLGSPSG LRTNFTTRQL TELEK

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Homeobox protein Hox-B1(HOXB1) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: homeobox B1
Protein Name: Homeobox protein Hox-B1

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human HOXB1 (176-220aa TARTFDWMKVKRNPPKTAKVSEPGLGSPSGLRTNFTTRQLTELEK), different from the related mouse sequence by four amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu HOXB1

Target: HOXB1 (Homeobox B1 (HOXB1))

Andere Bezeichnung: HOXB1 (HOXB1 Produkte)

Synonyme: HCFP3 antikoerper, HOX2 antikoerper, HOX2I antikoerper, Hox-2.9 antikoerper, Z-3 antikoerper, hoxb1 antikoerper, id:ibd3532 antikoerper, Ghox-lab antikoerper, HOXB-1 antikoerper, XHox-b1 antikoerper, hox-2.9 antikoerper, hoxb-1 antikoerper, homeobox B1 antikoerper, homeobox B1a antikoerper, homeo box B1 antikoerper, homeobox protein Hox-B1a antikoerper, homeobox B1 L homeolog antikoerper, HOXB1 antikoerper, Hoxb1 antikoerper, hoxb1a antikoerper, LOC101062167 antikoerper, hoxb1.L antikoerper

Hintergrund: Homeobox protein Hox-B1 is a protein that in humans is encoded by the HOXB1 gene. This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXB genes located in a cluster on chromosome 17.

Synonyms: Homeobox protein Hox-B1, Homeobox protein Hox-2I, HOXB1, HOX2I

Gen-ID: 3211

UniProt: P14653