CRX Antikörper (C-Term)
-
- Target Alle CRX Antikörper anzeigen
- CRX (Cone-Rod Homeobox (CRX))
-
Bindungsspezifität
- AA 265-299, C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CRX Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Cone-rod homeobox protein(CRX) detection. Tested with WB in Human.
- Sequenz
- DSLEFKDPTG TWKFTYNPMD PLDYKDQSAW KFQIL
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Cone-rod homeobox protein(CRX) detection. Tested with WB in Human.
Gene Name: cone-rod homeobox
Protein Name: Cone-rod homeobox protein - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human CORD2 (265-299aa DSLEFKDPTGTWKFTYNPMDPLDYKDQSAWKFQIL), identical to the related mouse and rat sequences.
- Isotyp
- IgG
- Top Product
- Discover our top product CRX Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Lagerung
- 4 °C,-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- CRX (Cone-Rod Homeobox (CRX))
- Andere Bezeichnung
- CRX (CRX Produkte)
- Synonyme
- Xotx5 antikoerper, Xotx5b antikoerper, cord2 antikoerper, crd antikoerper, otx5 antikoerper, otx5b antikoerper, rx antikoerper, CRX antikoerper, crx antikoerper, otx5-b antikoerper, CORD2 antikoerper, CRD antikoerper, LCA7 antikoerper, OTX3 antikoerper, Crx1 antikoerper, otx5-A antikoerper, cone-rod homeobox antikoerper, cone-rod homeobox L homeolog antikoerper, cone-rod homeobox S homeolog antikoerper, crx antikoerper, CRX antikoerper, Crx antikoerper, crx.L antikoerper, crx.S antikoerper
- Hintergrund
-
Cone-rod homeobox protein is a protein that in humans is encoded by the CRX gene. The protein encoded by this gene is a photoreceptor-specific transcription factor which plays a role in the differentiation of photoreceptor cells. This homeodomain protein is necessary for the maintenance of normal cone and rod function. Mutations in this gene are associated with photoreceptor degeneration, Leber congenital amaurosis type III and the autosomal dominant cone-rod dystrophy 2. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some variants has not been determined.
Synonyms: CORD 2 | CRD | CRX | LCA 7 | LCA7 | OTX 3 | OTX3 | O43186 - Gen-ID
- 1406
- UniProt
- O43186
-