Annexin IV Antikörper (Middle Region)
-
- Target Alle Annexin IV (ANXA4) Antikörper anzeigen
- Annexin IV (ANXA4) (Annexin A4 (ANXA4))
-
Bindungsspezifität
- AA 119-152, Middle Region
-
Reaktivität
- Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Annexin IV Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Annexin A4(ANXA4) detection. Tested with WB in Human,Mouse,Rat.
- Sequenz
- EEIRRISQTY QQQYGRSLED DIRSDTSFMF QRVL
- Kreuzreaktivität (Details)
-
Predicted Cross Reactivity: human
No cross reactivity with other proteins.
Predicted Cross Reactivity: Species predicted to be fit for the product based on sequence similarities. - Produktmerkmale
-
Rabbit IgG polyclonal antibody for Annexin A4(ANXA4) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: annexin A4
Protein Name: Annexin A4 - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human Annexin IV (119-152aa EEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVL), different from the related mouse and rat sequences by three amino acids.
- Isotyp
- IgG
- Top Product
- Discover our top product ANXA4 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Lagerung
- 4 °C,-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
-
Ancient and modern anticonvulsants act synergistically in a KCNQ potassium channel binding pocket." in: Nature communications, Vol. 9, Issue 1, pp. 3845, (2018) (PubMed).
: "
-
Ancient and modern anticonvulsants act synergistically in a KCNQ potassium channel binding pocket." in: Nature communications, Vol. 9, Issue 1, pp. 3845, (2018) (PubMed).
-
- Target
- Annexin IV (ANXA4) (Annexin A4 (ANXA4))
- Andere Bezeichnung
- ANXA4 (ANXA4 Produkte)
- Hintergrund
-
ANXA4 (Annexin A4), also known as ANX4, is a protein that in humans is encoded by the ANXA4 gene. It belongs to the annexin family of calcium-dependent phospholipid binding proteins. By PCR analysis of somatic cell hybrids and in situ hybridization with a cDNA probe, the human ANXA4 gene is mapped to chromosome 2p13. Isolated from human placenta, ANXA4 encodes a protein that has possible interactions with ATP, and has in vitro anticoagulant activity and also inhibits phospholipase A2 activity. And ANXA4 is almost exclusively expressed in epithelial cells.
Synonyms: Annexin A4 | 35-beta calcimedin | Annexin IV | Annexin-4 | Carbohydrate-binding protein p33/p41 | Chromobindin-4 | Endonexin I | Lipocortin IV | P32.5 | PP4-X | Placental anticoagulant protein II | PAP-II | Protein II | ANXA4 | ANX4 | P09525 - Gen-ID
- 307
- UniProt
- P09525
-