Telefon:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@antikoerper-online.de

NOS2 Antikörper (C-Term)

NOS2 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
Produktnummer ABIN5518782
  • Target Alle NOS2 Antikörper anzeigen
    NOS2 (Nitric Oxide Synthase 2, Inducible (NOS2))
    Bindungsspezifität
    • 16
    • 16
    • 12
    • 10
    • 8
    • 6
    • 6
    • 4
    • 4
    • 4
    • 3
    • 3
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 1088-1126, C-Term
    Reaktivität
    • 106
    • 72
    • 68
    • 17
    • 2
    • 1
    Human
    Wirt
    • 124
    • 14
    Kaninchen
    Klonalität
    • 119
    • 19
    Polyklonal
    Konjugat
    • 70
    • 16
    • 8
    • 6
    • 4
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Dieser NOS2 Antikörper ist unkonjugiert
    Applikation
    • 111
    • 42
    • 38
    • 31
    • 27
    • 26
    • 25
    • 18
    • 17
    • 16
    • 7
    • 4
    • 2
    Western Blotting (WB)
    Verwendungszweck
    Rabbit IgG polyclonal antibody for Nitric oxide synthase, inducible(NOS2) detection. Tested with WB in Human.
    Sequenz
    ARDVAHTLKQ LVAAKLKLNE EQVEDYFFQL KSQKRYHED
    Kreuzreaktivität (Details)
    No cross reactivity with other proteins.
    Produktmerkmale
    Rabbit IgG polyclonal antibody for Nitric oxide synthase, inducible(NOS2) detection. Tested with WB in Human.
    Gene Name: nitric oxide synthase 2, inducible
    Protein Name: Nitric oxide synthase, inducible
    Aufreinigung
    Immunogen affinity purified.
    Immunogen
    A synthetic peptide corresponding to a sequence at the C-terminus of human iNOS (1088-1126aa ARDVAHTLKQLVAAKLKLNEEQVEDYFFQLKSQKRYHED), different from the related mouse sequence by five amino acids, and from the related rat sequence by four amino acids.
    Isotyp
    IgG
    Top Product
    Discover our top product NOS2 Primärantikörper
  • Applikationshinweise
    WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
    Notes: Tested Species: Species with positive results.
    Other applications have not been tested. Optimal dilutions should be determined by end users.
    Kommentare

    Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

    Beschränkungen
    Nur für Forschungszwecke einsetzbar
  • Format
    Lyophilized
    Rekonstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Konzentration
    500 μg/mL
    Buffer
    Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
    Konservierungsmittel
    Sodium azide
    Vorsichtsmaßnahmen
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Lagerung
    4 °C,-20 °C
    Informationen zur Lagerung
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
  • Liu, Zhang, Han, Wang, Liu, Zhang, Zhou, Xiang: "[Corrigendum] Inhibition of BTK protects lungs from trauma-hemorrhagic shock-induced injury in rats." in: Molecular medicine reports, Vol. 17, Issue 5, pp. 6926, (2018) (PubMed).

    Sun, Yang, Zhang, Zhao: "Esculentoside A ameliorates cecal ligation and puncture-induced acute kidney injury in rats." in: Experimental animals, (2017) (PubMed).

    Wang, Chai, He, Ai, Sun, Huang, Li: "Intermittent hypoxia simulating obstructive sleep apnea causes pulmonary inflammation and activates the Nrf2/HO-1 pathway." in: Experimental and therapeutic medicine, Vol. 14, Issue 4, pp. 3463-3470, (2017) (PubMed).

    Huang, Chen, Wang, Wang, Ning, He, Hu, Yuan, Li, Wang, Liu, Chen, Ren, Sun: "Detecting cell-in-cell structures in human tumor samples by E-cadherin/CD68/CD45 triple staining." in: Oncotarget, Vol. 6, Issue 24, pp. 20278-87, (2016) (PubMed).

    Lin, Sun, Wang, Zheng, Zhang, Zheng: "Celastrol Ameliorates Ulcerative Colitis-Related Colorectal Cancer in Mice via Suppressing Inflammatory Responses and Epithelial-Mesenchymal Transition." in: Frontiers in pharmacology, Vol. 6, pp. 320, (2016) (PubMed).

    Dhillon, Mastropaolo, Murchie, Griffiths, Thöni, Elkadri, Xu, Mack, Walters, Guo, Mack, Huynh, Baksh, Silverberg, Brumell, Snapper, Muise: "Higher activity of the inducible nitric oxide synthase contributes to very early onset inflammatory bowel disease." in: Clinical and translational gastroenterology, Vol. 5, pp. e46, (2014) (PubMed).

    Zhao, Xiong, Mao, Meng, Lei, Li, Deng, Chen, Tu, Lu, Yang, He: "Atmospheric pressure room temperature plasma jets facilitate oxidative and nitrative stress and lead to endoplasmic reticulum stress dependent apoptosis in HepG2 cells." in: PLoS ONE, Vol. 8, Issue 8, pp. e73665, (2013) (PubMed).

    Long, Yu, Shuai, Guo, Duan, Xu, Li: "The hypoglycemic effect of the kelp on diabetes mellitus model induced by alloxan in rats." in: International journal of molecular sciences, Vol. 13, Issue 3, pp. 3354-65, (2012) (PubMed).

    Zhang, Wei, Wang, Ding, Wang, Shi: "Cell-specific expression and immunolocalization of nitric oxide synthase isoforms and the related nitric oxide/cyclic GMP signaling pathway in the ovaries of neonatal and immature rats." in: Journal of Zhejiang University. Science. B, Vol. 12, Issue 1, pp. 55-64, (2011) (PubMed).

    Wang, Du, Wang, Kuang, Wang: "Z-ligustilide attenuates lipopolysaccharide-induced proinflammatory response via inhibiting NF-kappaB pathway in primary rat microglia." in: Acta pharmacologica Sinica, Vol. 31, Issue 7, pp. 791-7, (2010) (PubMed).

    Wu, Yin, Yao, Haefliger: "Inhibition by brimonidine of forskolin-induced nitric oxide synthase expression in human ciliary bodies in vitro." in: Molecular vision, Vol. 13, pp. 493-6, (2007) (PubMed).

    Sun, Han, Jia, Jiang, Wang, Zhang, Han, Jiang: "Expressions of inducible nitric oxide synthase and matrix metalloproteinase-9 and their effects on angiogenesis and progression of hepatocellular carcinoma." in: World journal of gastroenterology, Vol. 11, Issue 38, pp. 5931-7, (2006) (PubMed).

    Wang, Ji, Wang, Gu: "Anti-cancer effect of iNOS inhibitor and its correlation with angiogenesis in gastric cancer." in: World journal of gastroenterology, Vol. 11, Issue 25, pp. 3830-3, (2005) (PubMed).

    Xu, Deng, Zhu, Lin: "Role of inducible nitric oxide synthase expression in aberrant crypt foci-adenoma-carcinoma sequence." in: World journal of gastroenterology, Vol. 9, Issue 6, pp. 1246-50, (2003) (PubMed).

    Sassenroth, Trinkmann: "[Implantation of a Binkhorst lens in chronic simple glaucoma]." in: Fortschritte der Ophthalmologie : Zeitschrift der Deutschen Ophthalmologischen Gesellschaft, Vol. 82, Issue 2, pp. 186, (1985) (PubMed).

    Shapiro: "Portrait of a pioneer laryngologist." in: Eye, ear, nose & throat monthly, Vol. 53, Issue 11, pp. 460-4, (1975) (PubMed).

    Achten: "Diseases of the dermis. General considerations." in: Archives belges de dermatologie et de syphiligraphie, Vol. 28, Issue 1, pp. 1-13, (1973) (PubMed).

  • Target
    NOS2 (Nitric Oxide Synthase 2, Inducible (NOS2))
    Andere Bezeichnung
    NOS2 (NOS2 Produkte)
    Synonyme
    HEP-NOS antikoerper, INOS antikoerper, NOS antikoerper, NOS2A antikoerper, NOS-II antikoerper, Nos-2 antikoerper, Nos2a antikoerper, i-NOS antikoerper, iNOS antikoerper, iNos antikoerper, NOS2a antikoerper, NOS2 antikoerper, BmNOS2 antikoerper, Nsl antikoerper, nos2 antikoerper, nitric oxide synthase 2 antikoerper, nitric oxide synthase 2, inducible antikoerper, inducible nitric oxide synthase antikoerper, inducible nitric-oxide synthase antikoerper, nanos C2HC-type zinc finger 2 antikoerper, NOS2 antikoerper, Nos2 antikoerper, nos2 antikoerper, LOC396821 antikoerper, NANOS2 antikoerper
    Hintergrund
    Nitric oxide synthase, inducible is an enzyme that in humans is encoded by the NOS2 gene. Nitric oxide (NO) is a messenger molecule with diverse functions throughout the body. In the brain and peripheral nervous system, NO displays many properties of a neurotransmitter, it is implicated in neurotoxicity associated with stroke and neurodegenerative diseases, neural regulation of smooth muscle, including peristalsis, and penile erection. Three different NOS isoforms have been identified which fall into two distinct types, constitutive and inducible. The inducible NOS (iNOS) isoform is expressed in a variety of cell types and tissues in response to inflammatory agents and cytokines. The human iNOS (NOS2) gene is approximately 37 kb in length and consists of 26 exons and 25 introns. NOS2-derived NO is a prerequisite for cytokine signaling and function in innate immunity.

    Synonyms: Ascites | HEP NOS | Hepatocyte NOS | HEPNOS | HEP-NOS | Inducible NOS | iNOS | NANOS2 | nitric oxide synthase 2, inducible | NOS 2A | NOS2A | P60321
    Gen-ID
    4843
    UniProt
    P35228
    Pathways
    Retinoic Acid Receptor Signaling Pathway, Cellular Response to Molecule of Bacterial Origin, Inositol Metabolic Process, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process
Sie sind hier:
Kundenservice