NAA15 Antikörper (N-Term)

Produktnummer ABIN5518778

Produktdetails anti-NAA15 Antikörper

Target: NAA15 (N(alpha)-Acetyltransferase 15, NatA Auxiliary Subunit (NAA15))

Bindungsspezifität: AA 244-287, N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NAA15 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for N-alpha-acetyltransferase 15, NatA auxiliary subunit(NAA15) detection. Tested with WB, IHC-P in Human,Mouse.

Sequenz: ADVYRGLQER NPENWAYYKG LEKALKPANM LERLKIYEEA WTKY

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for N-alpha-acetyltransferase 15, NatA auxiliary subunit(NAA15) detection. Tested with WB, IHC-P in Human,Mouse.
Gene Name: N(alpha)-acetyltransferase 15, NatA auxiliary subunit
Protein Name: N-alpha-acetyltransferase 15, NatA auxiliary subunit

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human NARG1 (244-287aa ADVYRGLQERNPENWAYYKGLEKALKPANMLERLKIYEEAWTKY), different from the related mouse sequence by one amino acid.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Mouse, Predicted Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu NAA15

Target: NAA15 (N(alpha)-Acetyltransferase 15, NatA Auxiliary Subunit (NAA15))

Andere Bezeichnung: NAA15 (NAA15 Produkte)

Synonyme: Ga19 antikoerper, NARG1 antikoerper, NATH antikoerper, TBDN100 antikoerper, 5730450D16Rik antikoerper, 6330400I15 antikoerper, ASTBDN antikoerper, Narg1 antikoerper, Tbdn-1 antikoerper, mNAT1 antikoerper, narg1l antikoerper, N(alpha)-acetyltransferase 15, NatA auxiliary subunit antikoerper, N(alpha)-acetyltransferase 15, NatA auxiliary subunit S homeolog antikoerper, NAA15 antikoerper, Naa15 antikoerper, naa15.S antikoerper

Hintergrund: NMDA receptor-regulated protein 1 (NARG1), also known as GA19 or Tbdn100 is a protein that in humans is encoded by the NAA15 gene. It is mapped to chromosome 4. NARG1 is the auxiliary subunit of the NatA (Nα-acetyltransferase A) complex. Both, Naa15 and Naa16 interact with the ribosome in yeast (via the ribosomal proteins, uL23 and uL29), humans and rat, thereby linking the NatA/Naa10 to the ribosome and facilitating co-translational acetylation of nascent polypeptide chains as they emerges from the exit tunnel. Furthermore, Naa15 might act as a scaffold for other factors, including the chaperone like protein HYPK (Huntingtin Interacting Protein K) and Naa50, the catalytic acetyltransferase subunit of NatE.

Synonyms: ASTBDN | GA19 | mNAT1 | Naa15 | NATH | Tbdn 1 | Tbdn100 | tubedown-1 | Q9BXJ9

Gen-ID: 80155