ANGPTL4 Antikörper (C-Term)

Produktnummer ABIN5518734

Produktdetails anti-ANGPTL4 Antikörper

Target: ANGPTL4 (Angiopoietin-Like 4 (ANGPTL4))

Bindungsspezifität: AA 369-406, C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ANGPTL4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), ELISA

Verwendungszweck: Rabbit IgG polyclonal antibody for Angiopoietin-related protein 4(ANGPTL4) detection. Tested with WB, ELISA in Human.

Sequenz: QQRQKLKKGI FWKTWRGRYY PLQATTMLIQ PMAAEAAS

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Angiopoietin-related protein 4(ANGPTL4) detection. Tested with WB, ELISA in Human.
Gene Name: angiopoietin-like 4
Protein Name: Angiopoietin-related protein 4

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human ANGPTL4 (369-406aa QQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAAS), different from the related mouse and rat sequences by seven amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
ELISA: Concentration: 0.1-0.5 μg/mL, Tested Species: Human

Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu ANGPTL4

Target: ANGPTL4 (Angiopoietin-Like 4 (ANGPTL4))

Andere Bezeichnung: ANGPTL4 (ANGPTL4 Produkte)

Synonyme: ANGPTL2 antikoerper, ARP4 antikoerper, FIAF antikoerper, HFARP antikoerper, NL2 antikoerper, PGAR antikoerper, pp1158 antikoerper, Arp4 antikoerper, Bk89 antikoerper, Fiaf antikoerper, Hfarp antikoerper, Ng27 antikoerper, Pgar antikoerper, Pgarg antikoerper, Pp1158 antikoerper, ANGPTL4 antikoerper, fiaf antikoerper, im:7144703 antikoerper, si:rp71-39b20.7 antikoerper, angiopoietin like 4 antikoerper, angiopoietin-like 4 antikoerper, ANGPTL4 antikoerper, Angptl4 antikoerper, angptl4 antikoerper

Hintergrund: Angiopoietin-related protein 4 (Angptl4) is a protein that in humans is encoded by the ANGPTL4 gene. This gene is a member of the angiopoietin/angiopoietin-like gene family and encodes a glycosylated, secreted protein with a fibrinogen C-terminal domain. And this gene is induced under hypoxic conditions in endothelial cells and is the target of peroxisome proliferation activators. By radiation hybrid analysis, Angptl4 gene is mapped to 19p13.3. ANGPTL4 contributed to tumor growth and protected cells from anoikis, a form of programmed cell death induced when contact-dependent cells detach from the surrounding tissue matrix.

Synonyms: Angiopoietin like 4 | Angiopoietin related protein 4 | Angiopoietinlike 4 | angiopoietin-like 4 | Angiopoietin-like 4 | Angiopoietin-like protein 4 | Angiopoietinrelated protein 4 | ANGL4 | angptl 4 | ANGPTL2 | ANGPTL4 | ARP4 | PGAR | HFARP | pp1158 | PSEC0166 | TGQTL | Q9BY76

Gen-ID: 51129

Pathways: Regulation of Lipid Metabolism by PPARalpha