ALOX12 Antikörper (N-Term)

Produktnummer ABIN5518730

Produktdetails anti-ALOX12 Antikörper

Target: ALOX12 (Arachidonate 12-Lipoxygenase (ALOX12))

Bindungsspezifität: AA 186-231, N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ALOX12 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Arachidonate 12-lipoxygenase, 12S-type(ALOX12) detection. Tested with WB in Human,Mouse,Rat.

Sequenz: ALKRVYTLLS SWNCLEDFDQ IFWGQKSALA EKVRQCWQDD ELFSYQ

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Arachidonate 12-lipoxygenase, 12S-type(ALOX12) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: arachidonate 12-lipoxygenase
Protein Name: Arachidonate 12-lipoxygenase, 12S-type

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human 12 Lipoxygenase (186-231aa ALKRVYTLLSSWNCLEDFDQIFWGQKSALAEKVRQCWQDDELFSYQ), different from the related mouse sequence by six amino acids, and from the related rat sequence by seven amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu ALOX12

Target: ALOX12 (Arachidonate 12-Lipoxygenase (ALOX12))

Andere Bezeichnung: ALOX12 (ALOX12 Produkte)

Synonyme: 15-LOX-1 antikoerper, 15LOX-1 antikoerper, 12-LOX antikoerper, 12S-LOX antikoerper, LOG12 antikoerper, ALOX12 antikoerper, ALOX15 antikoerper, 9930022G08Rik antikoerper, Alox12p antikoerper, P-12LO antikoerper, 12-LO antikoerper, zgc:64120 antikoerper, wu:fb72a11 antikoerper, arachidonate 15-lipoxygenase antikoerper, arachidonate 12-lipoxygenase, 12S type antikoerper, arachidonate 12-lipoxygenase antikoerper, arachidonate 12-lipoxygenase, 12S-type antikoerper, ALOX15 antikoerper, ALOX12 antikoerper, Alox12 antikoerper, alox12 antikoerper, LOC100072916 antikoerper

Hintergrund: ALOX12, Arachidonate 12-lipoxygenase, is an enzyme that in humans is encoded by the ALOX12 gene. By fluorescence in situ hybridization, the ALOX12 gene is located in band 17p13.1. The gene consists of 14 exons with 13 introns and spans approximately 15 kb of DNA Arachidonate 12-lipoxygenase introduces a molecular oxygen into the C-12 position of arachidonic acid to produce 12(S)-hydroperoxy-5,8,10,14-eicosatetraenoic acid. The major pathway of arachidonic acid metabolism in human platelets proceeds via a 12-lipoxygenase enzyme. Expression of the LOG12 gene was detected in human erythroleukemia cells, platelets, and human umbilical vein endothelial cells by reverse transcription-PCR analysis.

Synonyms: 12 Lipoxygenase | ALOX12 | arachidonate 12-lipoxygenase | EC1.13.11.31 | Lipoxin synthase 12-LO | LOG12 | P18054 | Platelet-type lipoxygenase 12

Gen-ID: 239

UniProt: P18054

Pathways: Positive Regulation of Endopeptidase Activity