ADAM28 Antikörper (N-Term)
-
- Target Alle ADAM28 Antikörper anzeigen
- ADAM28 (ADAM Metallopeptidase Domain 28 (ADAM28))
-
Bindungsspezifität
- AA 207-248, N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ADAM28 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Disintegrin and metalloproteinase domain-containing protein 28(ADAM28) detection. Tested with WB in Human.
- Sequenz
- EYYLVLDNGE FKRYNENQDE IRKRVFEMAN YVNMLYKKLN TH
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Disintegrin and metalloproteinase domain-containing protein 28(ADAM28) detection. Tested with WB in Human.
Gene Name: ADAM metallopeptidase domain 28
Protein Name: Disintegrin and metalloproteinase domain-containing protein 28 - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human ADAM28 (207-248aa EYYLVLDNGEFKRYNENQDEIRKRVFEMANYVNMLYKKLNTH), different from the related mouse sequence by eleven amino acids.
- Isotyp
- IgG
- Top Product
- Discover our top product ADAM28 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Lagerung
- 4 °C,-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- ADAM28 (ADAM Metallopeptidase Domain 28 (ADAM28))
- Andere Bezeichnung
- ADAM28 (ADAM28 Produkte)
- Synonyme
- C130072N01Rik antikoerper, D430033C21Rik antikoerper, Dtgn1 antikoerper, MDC-L antikoerper, MDC-Lm antikoerper, MDC-Ls antikoerper, MDCL antikoerper, TECADAM antikoerper, eMDCII antikoerper, ADAM 28 antikoerper, ADAM23 antikoerper, eMDC II antikoerper, ADAM metallopeptidase domain 28 antikoerper, a disintegrin and metallopeptidase domain 28 antikoerper, Adam28 antikoerper, ADAM28 antikoerper
- Hintergrund
-
Disintegrin and metalloproteinase domain-containing protein 28 is an enzyme that in humans is encoded by the ADAM28 gene. This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The protein encoded by this gene is a lymphocyte-expressed ADAM protein. And this gene is present in a gene cluster with other members of the ADAM family on chromosome 8. Alternative splicing results in multiple transcript variants.
Synonyms: ADAM28 | ADAM 28 | ADAM23 | eMDC II | eMDCII | MDC L | MDCL | Q9UKQ2 - Gen-ID
- 10863
-