Telefon:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antikoerper-online.de

GrpE-Like 1, Mitochondrial (GRPEL1) (AA 1-217) Antikörper Primary Antibody

GRPEL1 Reaktivität: Human WB Wirt: Maus Polyclonal unconjugated
Produktnummer ABIN529247
$600.00
Zzgl. Versandkosten $45.00
50 μg
local_shipping Lieferung nach: Vereinigte Staaten von Amerika
Lieferung in 11 bis 12 Werktagen
  • Target
    GrpE-Like 1, Mitochondrial (GRPEL1)
    Bindungsspezifität
    AA 1-217
    • 8
    • 8
    • 7
    • 7
    • 2
    • 1
    • 1
    • 1
    • 1
    Reaktivität
    Human
    • 23
    • 3
    • 3
    • 1
    • 1
    Wirt
    Maus
    • 21
    • 2
    Klonalität
    Polyklonal
    Konjugat
    Unkonjugiert
    • 11
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    Applikation
    Western Blotting (WB)
    • 22
    • 19
    • 4
    • 1
    Verwendungszweck
    Mouse polyclonal antibody raised against a full-length human GRPEL1 protein.
    Marke
    MaxPab®
    Kreuzreaktivität
    Human, Maus, Ratte (Rattus)
    Immunogen

    immunogen: GRPEL1 (NP_079472.1, 1 a.a. ~ 217 a.a) full-length human protein.

    Immunogen Sequence: MAAQCVRLARRSLPALALSLRPSPRLLCTATKQKNSGQNLEEDMGQSEQKADPPATEKTLLEEKVKLEEQLKETVEKYKRALADTENLRQRSQKLVEEAKLYGIQAFCKDLLEVADVLEKATQCVPKEEIKDDNPHLKNLYEGLVMTEVQIQKVFTKHGLLKLNPVGAKFDPYEHEALFHTPVEGKEPGTVALVSKVGYKLHGRTLRPALVGVVKEA

  • Applikationshinweise
    Optimal working dilution should be determined by the investigator.
    Kommentare

    Product Quality tested by: Antibody reactive against mammalian transfected lysate.

    Beschränkungen
    Nur für Forschungszwecke einsetzbar
  • Buffer
    In 1x PBS, pH 7.4
    Handhabung
    Aliquot to avoid repeated freezing and thawing.
    Lagerung
    -20 °C
    Informationen zur Lagerung
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Target
    GrpE-Like 1, Mitochondrial (GRPEL1)
    Andere Bezeichnung
    GRPEL1 (GRPEL1 Antibody Abstract)
    Synonyme
    AA408748, mt-GrpE1, mt-Grpel1, GrpE1, HMGE, GrpE-like 1, mitochondrial, GrpE like 1, mitochondrial, Grpel1, GRPEL1
    Hintergrund
    Full Gene Name: GrpE-like 1, mitochondrial (E. coli)
    Synonyms: FLJ25609,HMGE
    Gen-ID
    80273
    NCBI Accession
    NP_079472, NM_025196
    Pathways
    SARS-CoV-2 Protein Interaktom
Sie sind hier:
help Kundenservice