Tumor Protein, Translationally-Controlled 1 (TPT1) (AA 35-138) Antikörper

Details zu Produkt Nr. ABIN521072
Antigen
Epitop
AA 35-138
22
18
17
14
10
8
5
5
3
2
2
2
1
1
Reaktivität
Human
176
109
94
3
3
3
3
1
Wirt
Maus
173
17
Klonalität (Klon)
Monoklonal ()
Konjugat
Unkonjugiert
18
8
6
6
6
6
6
6
6
3
3
2
2
2
2
2
2
1
Applikation
ELISA, Western Blotting (WB)
133
77
47
31
30
29
15
11
10
8
5
3
3
2
2
2
Optionen
Verwendungszweck Mouse monoclonal antibody raised against a partial recombinant TPT1.
Immunogen

immunogen: TPT1 (AAH22436, 35 a.a. ~ 138 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Immunogen Sequence: GVDIVMNHHLQETSFTKEAYKKYIKDYMKSIKGKLEEQRPERVKPFMTGAAEQIKHILANFKNYQFFIGENMNPDGMVALLDYREDGVTPYMIFFKDGLEMEKC

Klon 2C4
Isotyp IgG2a kappa
Kreuzreaktivität Human, Maus, Ratte (Rattus)
Antigen
Andere Bezeichnung TPT1 (TPT1 Antibody Abstract)
Hintergrund Full Gene Name: tumor protein, translationally-controlled 1
Synonyms: FLJ27337,HRF,TCTP,p02
Gen-ID 7178
Pathways Response to Water Deprivation, Regulation of Cell Size, Negative Regulation of intrinsic apoptotic Signaling
Applikations-hinweise Optimal working dilution should be determined by the investigator.
Kommentare

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Beschränkungen Nur für Forschungszwecke einsetzbar
Buffer In 1x PBS, pH 7.4
Handhabung Aliquot to avoid repeated freezing and thawing.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Bilder des Herstellers
Image no. 1 for anti-Tumor Protein, Translationally-Controlled 1 (TPT1) (AA 35-138) antibody (ABIN521072) Detection limit for recombinant GST tagged TPT1 is approximately 0.3ng/ml as a captur...
Image no. 2 for anti-Tumor Protein, Translationally-Controlled 1 (TPT1) (AA 35-138) antibody (ABIN521072) TPT1 monoclonal antibody (M03), clone 2C4. Western Blot analysis of TPT1 expression i...
Image no. 3 for anti-Tumor Protein, Translationally-Controlled 1 (TPT1) (AA 35-138) antibody (ABIN521072) TPT1 monoclonal antibody (M03), clone 2C4. Western Blot analysis of TPT1 expression i...
Image no. 4 for anti-Tumor Protein, Translationally-Controlled 1 (TPT1) (AA 35-138) antibody (ABIN521072) TPT1 monoclonal antibody (M03), clone 2C4. Western Blot analysis of TPT1 expression i...
Image no. 5 for anti-Tumor Protein, Translationally-Controlled 1 (TPT1) (AA 35-138) antibody (ABIN521072) TPT1 monoclonal antibody (M03), clone 2C4 Western Blot analysis of TPT1 expression in...
Produkt verwendet in: Sinthujaroen, Wanachottrakul, Pinkaew, Petersen, Phongdara, Sheffield-Moore, Fujise: "Elevation of serum fortilin levels is specific for apoptosis and signifies cell death in vivo." in: BBA clinical, Vol. 2, pp. 103-111, 2015 (PubMed).