SMAD, Mothers Against DPP Homolog 1 (SMAD1) (AA 1-465) Antikörper

Details zu Produkt Nr. ABIN517611
Target
Bindungsspezifität
AA 1-465
21
20
15
14
13
10
9
9
8
5
5
4
4
4
4
4
3
3
3
2
2
2
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Reaktivität
Human
210
143
120
11
10
9
9
8
7
7
6
6
5
5
4
3
1
1
1
1
1
1
1
1
1
Wirt
Maus
202
23
1
Klonalität (Klon)
Monoklonal ()
Konjugat
Unkonjugiert
21
11
9
8
8
8
8
8
7
2
2
2
2
2
2
2
2
Applikation
Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), ELISA, Western Blotting (WB)
163
99
61
39
28
26
21
13
13
5
5
3
3
2
1
1
1
1
1
Optionen
Verwendungszweck Mouse monoclonal antibody raised against a full length recombinant SMAD1.
Immunogen

immunogen: SMAD1 (AAH01878.1, 1 a.a. ~ 465 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Immunogen Sequence: MNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQPSNCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEVCINPYHYKRVESPVLPPVLVPRHSEYNPQHSLLAQFRNLGQNEPHMPLNATFPDSFQQPNSHPFPHSPNSSYPNSPGSSSSTYPHSPTSSDPGSPFQMPADTPPPAYLPPEDPMTQDGSQPMDTNMMAPPLPSEINRGDVQAVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFTDPSNNKNRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNCNYHHGFHPTTVCKIPSGCSLKIFNNQEFAQLLAQSVNHGFETVYELTKMCTIRMSFVKGWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHNPISSVS

Klon 2A1
Isotyp IgG2b kappa
Kreuzreaktivität Human, Maus, Ratte (Rattus)
Target
Andere Bezeichnung SMAD1 (SMAD1 Antibody Abstract)
Hintergrund Full Gene Name: SMAD family member 1
Synonyms: BSP1,JV4-1,JV41,MADH1,MADR1
Gen-ID 4086
Pathways Stem Cell Maintenance, Regulation of Muscle Cell Differentiation, Skeletal Muscle Fiber Development
Applikations-hinweise Optimal working dilution should be determined by the investigator.
Kommentare

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Beschränkungen Nur für Forschungszwecke einsetzbar
Buffer In 1x PBS, pH 7.4
Handhabung Aliquot to avoid repeated freezing and thawing.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Bilder
Image no. 1 for anti-SMAD, Mothers Against DPP Homolog 1 (SMAD1) (AA 1-465) antibody (ABIN517611) SMAD1 monoclonal antibody (M04), clone 2A1 Western Blot analysis of SMAD1 expression ...
Image no. 2 for anti-SMAD, Mothers Against DPP Homolog 1 (SMAD1) (AA 1-465) antibody (ABIN517611) Immunoperoxidase of monoclonal antibody to SMAD1 on formalin-fixed paraffin-embedded ...
Image no. 3 for anti-SMAD, Mothers Against DPP Homolog 1 (SMAD1) (AA 1-465) antibody (ABIN517611) SMAD1 monoclonal antibody (M04), clone 2A1. Western Blot analysis of SMAD1 expression...
Image no. 4 for anti-SMAD, Mothers Against DPP Homolog 1 (SMAD1) (AA 1-465) antibody (ABIN517611) SMAD1 monoclonal antibody (M04), clone 2A1. Western Blot analysis of SMAD1 expression...
Image no. 5 for anti-SMAD, Mothers Against DPP Homolog 1 (SMAD1) (AA 1-465) antibody (ABIN517611) Western Blot detection against Immunogen (76.89 KDa) .
Image no. 6 for anti-SMAD, Mothers Against DPP Homolog 1 (SMAD1) (AA 1-465) antibody (ABIN517611) Immunofluorescence of monoclonal antibody to SMAD1 on HeLa cell. (antibody concentrat...
Image no. 7 for anti-SMAD, Mothers Against DPP Homolog 1 (SMAD1) (AA 1-465) antibody (ABIN517611) Immunofluorescence of monoclonal antibody to SMAD1 on HeLa cell. [antibody concentrat...