Telefon:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antikoerper-online.de

GNG5 Antikörper (G Protein gamma 5) (AA 1-68) Primary Antibody

GNG5 Reaktivität: Human ELISA, WB Wirt: Maus Monoclonal 3B8 unconjugated
Produktnummer ABIN516110
$524.00
Zzgl. Versandkosten $45.00
100 μg
local_shipping Lieferung nach: Vereinigte Staaten von Amerika
Lieferung in 11 bis 12 Werktagen
  • Target
    GNG5
    Bindungsspezifität
    AA 1-68
    • 4
    • 2
    • 2
    • 1
    • 1
    Reaktivität
    Human
    • 30
    • 21
    • 21
    • 1
    • 1
    Wirt
    Maus
    • 28
    • 2
    Klonalität
    Monoklonal
    • 29
    • 1
    Konjugat
    Dieser GNG5 Antikörper ist unkonjugiert
    • 11
    • 3
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Applikation
    ELISA, Western Blotting (WB)
    • 13
    • 11
    • 8
    • 3
    • 3
    • 2
    • 2
    • 1
    Verwendungszweck
    Mouse monoclonal antibody raised against a full-length recombinant GNG5.
    Kreuzreaktivität
    Human
    Immunogen

    immunogen: GNG5 (AAH03563, 1 a.a. ~ 68 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Immunogen Sequence: MSGSSSVAAMKKVVQQLRLEAGLNRVKVSQAAADLKQFCLQNAQHDPLLTGVSSSTNPFRPQKVCSFL

    Klon
    3B8
    Isotyp
    IgG2a kappa
  • Applikationshinweise
    Optimal working dilution should be determined by the investigator.
    Kommentare

    Product Quality tested by: Antibody Reactive Against Recombinant Protein.

    Beschränkungen
    Nur für Forschungszwecke einsetzbar
  • Buffer
    In 1x PBS, pH 7.4
    Handhabung
    Aliquot to avoid repeated freezing and thawing.
    Lagerung
    -20 °C
    Informationen zur Lagerung
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Target
    GNG5
    Andere Bezeichnung
    GNG5 (GNG5 Antibody Abstract)
    Synonyme
    G(y)5, G protein subunit gamma 5, guanine nucleotide binding protein (G protein), gamma 5, Gng5, GNG5
    Hintergrund
    Full Gene Name: guanine nucleotide binding protein (G protein), gamma 5
    Synonyms: FLJ92393
    Gen-ID
    2787
    Pathways
    Myometrial Relaxation and Contraction, SARS-CoV-2 Protein Interaktom
Sie sind hier:
help Kundenservice