Telefon:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antikoerper-online.de

Folate Receptor 3 (Gamma) (FOLR3) (AA 1-245) Antikörper Primary Antibody

FOLR3 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
Produktnummer ABIN515785
$350.67
Zzgl. Versandkosten $45.00
100 μg
local_shipping Lieferung nach: Vereinigte Staaten von Amerika
Lieferung in 11 bis 12 Werktagen
  • Target
    Folate Receptor 3 (Gamma) (FOLR3)
    Bindungsspezifität
    AA 1-245
    • 9
    • 8
    • 7
    • 2
    • 1
    Reaktivität
    Human
    • 27
    • 1
    • 1
    Wirt
    Kaninchen
    Klonalität
    Polyklonal
    Konjugat
    Unkonjugiert
    • 8
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Applikation
    Western Blotting (WB)
    • 22
    • 18
    • 1
    • 1
    Verwendungszweck
    Rabbit polyclonal antibody raised against a full-length human FOLR3 protein.
    Marke
    MaxPab®
    Kreuzreaktivität
    Human
    Immunogen

    immunogen: FOLR3 (AAI48786.1, 1 a.a. ~ 245 a.a) full-length human protein.

    Immunogen Sequence: MDMAWQMMQLLLLALVTAAGSAQPRSARARTDLLNVCMNAKHHKTQPSPEDELYGQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPTCKRHFIQDSCLYECSPNLGPWIRQVNQSWRKERILNVPLCKEDCERWWEDCRTSYTCKSNWHKGWNWTSGINECPAGALCSTFESYFPTPAALCEGLWSHSFKVSNYSRGSGRCIQMWFDSAQGNPNEEVAKFYAAAMNAGAPSRGIIDS

  • Applikationshinweise
    Optimal working dilution should be determined by the investigator.
    Kommentare

    Product Quality tested by: Antibody reactive against mammalian transfected lysate.

    Beschränkungen
    Nur für Forschungszwecke einsetzbar
  • Buffer
    In 1x PBS, pH 7.4
    Handhabung
    Aliquot to avoid repeated freezing and thawing.
    Lagerung
    -20 °C
    Informationen zur Lagerung
    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Target
    Folate Receptor 3 (Gamma) (FOLR3)
    Andere Bezeichnung
    FOLR3 (FOLR3 Antibody Abstract)
    Synonyme
    FR-G, FR-gamma, gamma-hFR, folate receptor 3, folate receptor gamma, FOLR3, LOC748291
    Hintergrund
    Full Gene Name: folate receptor 3 (gamma)
    Synonyms: FR-G,FR-gamma,gamma-hFR
    Gen-ID
    2352
    Pathways
    Dicarboxylic Acid Transport
Sie sind hier:
help Kundenservice