SECTM1 Antikörper

Produktnummer ABIN4952492

Der Kaninchen Polyklonal anti-SECTM1 Antikörper (ABIN4952492) detektiert spezifisch SECTM1 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Maus.

Kurzübersicht für SECTM1 Antikörper (ABIN4952492)

Target: SECTM1 (Secreted and Transmembrane 1 (SECTM1))

Reaktivität: Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SECTM1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SECTM1 Antikörper

Verwendungszweck: SECTM1 Antibody

Sequenz: KLHGFQAEFK NFNLTVNAAD RQKTEDLPVT KVPDK

Aufreinigung: Antigen affinity

Immunogen: Amino acids KLHGFQAEFKNFNLTVNAADRQKTEDLPVTKVPDK of mouse SECTM1 were used as the immunogen for the SECTM1 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the SECTM1 antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the SECTM1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu SECTM1

Target: SECTM1 (Secreted and Transmembrane 1 (SECTM1))

Andere Bezeichnung: SECTM1

Hintergrund: SECTM1B is also known as Sectm1 or K12. Secreted and transmembrane protein 1 is a protein that in humans is encoded by the SECTM1 gene. This gene encodes a transmembrane and secreted protein with characteristics of a type 1a transmembrane protein. It is found in a perinuclear Golgi-like pattern and thought to be involved in hematopoietic and/or immune system processes.

UniProt: Q9JL59