SECTM1 Antikörper

Produktnummer ABIN4952492

Produktdetails anti-SECTM1 Antikörper

Target: SECTM1 (Secreted and Transmembrane 1 (SECTM1))

Reaktivität: Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SECTM1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Antigen affinity

Immunogen: Amino acids KLHGFQAEFKNFNLTVNAADRQKTEDLPVTKVPDK of mouse SECTM1 were used as the immunogen for the SECTM1 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the SECTM1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the SECTM1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu SECTM1

Target: SECTM1 (Secreted and Transmembrane 1 (SECTM1))

Andere Bezeichnung: SECTM1 (SECTM1 Produkte)

Synonyme: K12 antikoerper, secreted and transmembrane 1 antikoerper, SECTM1 antikoerper

Hintergrund: SECTM1B is also known as Sectm1 or K12. Secreted and transmembrane protein 1 is a protein that in humans is encoded by the SECTM1 gene. This gene encodes a transmembrane and secreted protein with characteristics of a type 1a transmembrane protein. It is found in a perinuclear Golgi-like pattern and thought to be involved in hematopoietic and/or immune system processes.

UniProt: Q9JL59