ELAV (Embryonic Lethal, Abnormal Vision, Drosophila)-Like (ELAVL) Antikörper

Produktnummer ABIN4951387

Der Kaninchen Polyklonal anti-ELAV (Embryonic Lethal, Abnormal Vision, Drosophila)-Like Antikörper wird verwendet zum Nachweis von ELAV (Embryonic Lethal, Abnormal Vision, Drosophila)-Like in Proben von Maus, Ratte und Human. Er wurde validiert für IHC (p), WB und IF.

Kurzübersicht für ELAV (Embryonic Lethal, Abnormal Vision, Drosophila)-Like (ELAVL) Antikörper (ABIN4951387)

Target: ELAV (Embryonic Lethal, Abnormal Vision, Drosophila)-Like (ELAVL)

Reaktivität: Maus, Ratte, Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB), Immunofluorescence (IF)

Produktdetails

Verwendungszweck: HuD Antibody / ELAVL4

Sequenz: MEPQVSNGPT SNTSNGPSSN NRNCPSPMQT GATTDDSK

Aufreinigung: Antigen affinity

Immunogen: Amino acids MEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGATTDDSK of human ELAVL4/HuD were used as the immunogen for the HuD antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the HuD antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the HuD antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Antigendetails

Target: ELAV (Embryonic Lethal, Abnormal Vision, Drosophila)-Like (ELAVL)

Andere Bezeichnung: HuD / ELAVL4

Hintergrund: HuD, otherwise known as ELAV-like protein 4 or PNEM, is a protein that in humans is encoded by the ELAVL4 gene. This human gene is located at 1p34 by in situ hybridization. The HuD/ELAVL4 protein is anRNA-binding protein. ELAVL4 has specificity for 3-prime uridylate-rich untranslated regions of growth factor mRNAs. And HuD is expressed only in neurons and it binds toAU-rich element-containing mRNAs. As a result of this interaction the, half-life of the transcript is increased. Also, HuD is important in neurons during brain development and plasticity.

UniProt: P26378