FABP1 (liver) Antikörper

Produktnummer ABIN4950973

Der Kaninchen Polyklonal anti-FABP1 (liver) Antikörper wird verwendet zum Nachweis von FABP1 (liver) in Proben von Human, Maus, Ratte, Huhn und Affe. Er wurde validiert für WB und IHC (p).

Kurzübersicht für FABP1 (liver) Antikörper (ABIN4950973)

Target: FABP1 (liver) (LBFABP) (Liver Basic Fatty Acid Binding Protein (LBFABP))

Reaktivität: Human, Maus, Ratte, Huhn, Affe

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FABP1 (liver) Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Produktdetails anti-FABP1 (liver) Antikörper

Verwendungszweck: FABP Antibody (liver)

Sequenz: KYQLQSQENF EAFMKAIGLP EELIQKGKDI K

Aufreinigung: Antigen affinity

Immunogen: Amino acids KYQLQSQENFEAFMKAIGLPEELIQKGKDIK of human FABP were used as the immunogen for the FABP antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the FABP antibody should be determined by the researcher.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: 4 °C,-20 °C

Informationen zur Lagerung: After reconstitution, the FABP antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Details zu FABP1 (liver)

Target: FABP1 (liver) (LBFABP) (Liver Basic Fatty Acid Binding Protein (LBFABP))

Andere Bezeichnung: FABP1 (liver)

Hintergrund: Fatty acid binding protein 1, liver, also known as FABP1 or FABPL, is a human gene locating at 2p11. FABP1 encodes the fatty acid binding protein found in liver. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind free fatty acids, their CoA derivatives, bilirubin, organic anions, and other small molecules. FABP1 and FABP6 (the ileal fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metaboism. The liver form of FABP may be identical to the major liver protein-1 (Lvp-1), which is encoded by a gene situated within 1 cM of Ly-2.

UniProt: P07148