BCAR3 Antikörper

Produktnummer ABIN4950307

Der Kaninchen Polyklonal anti-BCAR3 Antikörper wird verwendet zum Nachweis von BCAR3 in Proben von Human, Maus und Ratte. Er wurde validiert für WB und IHC (p).

Kurzübersicht für BCAR3 Antikörper (ABIN4950307)

Target: BCAR3 (Breast Cancer Anti-Estrogen Resistance 3 (BCAR3))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser BCAR3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Produktdetails anti-BCAR3 Antikörper

Aufreinigung: Antigen affinity

Immunogen: Amino acids KGAQVNQTERYEKFNQILTALSRKLEPPPVKQAEL of human BCAR3 were used as the immunogen for the BCAR3 antibody.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: Optimal dilution of the BCAR3 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Lagerung: -20 °C

Informationen zur Lagerung: After reconstitution, the BCAR3 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Details zu BCAR3

Target: BCAR3 (Breast Cancer Anti-Estrogen Resistance 3 (BCAR3))

Andere Bezeichnung: BCAR3

Hintergrund: Breast cancer anti-estrogen resistance protein 3 is a protein that in humans is encoded by the BCAR3 gene. Breast tumors are initially dependent on estrogens for growth and progression and can be inhibited by anti-estrogens such as tamoxifen. However, breast cancers progress to become anti-estrogen resistant. BCAR3 was identified in the search for genes involved in the development of estrogen resistance. The gene encodes a component of intracellular signal transduction that causes estrogen-independent proliferation in human breast cancer cells. The protein contains a putative src homology 2 (SH2) domain, a hall mark of cellular tyrosine kinase signaling molecules, and is partly homologous to the cell division cycle protein CDC48. Multiple transcript variants encoding different isoforms have been found for this gene.

UniProt: O75815