ZP1 Antikörper (N-Term)

Produktnummer ABIN4886775

Produktdetails anti-ZP1 Antikörper

Target: ZP1 (Zona Pellucida Glycoprotein 1 (ZP1))

Bindungsspezifität: AA 102-139, N-Term

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ZP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Zona pellucida sperm-binding protein 1(ZP1) detection. Tested with WB in Human,Rat.

Sequenz: HVLEKDGRFH LRVFMEAVLP NGRVDVAQDA TLICPKPD

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Zona pellucida sperm-binding protein 1(ZP1) detection. Tested with WB in Human,Rat.
Gene Name: zona pellucida glycoprotein 1
Protein Name: Zona pellucida sperm-binding protein 1

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human ZP1 (102-139aa HVLEKDGRFHLRVFMEAVLPNGRVDVAQDATLICPKPD), different from the related mouse sequence by four amino acids, and from the related rat sequence by five amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu ZP1

Target: ZP1 (Zona Pellucida Glycoprotein 1 (ZP1))

Andere Bezeichnung: ZP1 (ZP1 Produkte)

Synonyme: zona pellucida glycoprotein 1 (sperm receptor) antikoerper, zona pellucida glycoprotein 1 antikoerper, ZP1 antikoerper, Zp1 antikoerper

Hintergrund: Zona pellucida sperm-binding protein 1 (ZP1) is a protein that belopngs to the mammalian zona pellucida. The zona pellucida is an extracellular matrix that surrounds the oocyte and early embryo. It is composed primarily of three or four glycoproteins with various functions during fertilization and preimplantation development. Zp1 ensures the structural integrity of the zona pellucida. Mutations in this gene are a cause of oocyte maturation defect and infertility. And this gene is mapped to chromosome 11q12.2.

Synonyms: Zp1 | Zp-1 | Zp 1 | P60852

Gen-ID: 22917

UniProt: P60852