ST7 Antikörper (Middle Region)

Produktnummer ABIN4886732

Produktdetails anti-ST7 Antikörper

Target: ST7 (Suppression of Tumorigenicity 7 (ST7))

Bindungsspezifität: AA 268-309, Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ST7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Suppressor of tumorigenicity 7 protein(ST7) detection. Tested with WB in Human.

Sequenz: DGCYRRSQQL QHHGSQYEAQ HRRDTNVLVY IKRRLAMCAR RL

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Suppressor of tumorigenicity 7 protein(ST7) detection. Tested with WB in Human.
Gene Name: suppression of tumorigenicity 7
Protein Name: Suppressor of tumorigenicity 7 protein

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human ST7 (268-309aa DGCYRRSQQLQHHGSQYEAQHRRDTNVLVYIKRRLAMCARRL), identical to the related mouse and rat sequences.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu ST7

Target: ST7 (Suppression of Tumorigenicity 7 (ST7))

Andere Bezeichnung: ST7 (ST7 Produkte)

Synonyme: ETS7q antikoerper, FAM4A antikoerper, FAM4A1 antikoerper, HELG antikoerper, RAY1 antikoerper, SEN4 antikoerper, TSG7 antikoerper, 9430001H04Rik antikoerper, Fam4a2 antikoerper, suppression of tumorigenicity 7 antikoerper, ST7 antikoerper, St7 antikoerper

Hintergrund: Suppressor of tumorigenicity protein 7 is a protein that in humans is encoded by the ST7 gene. The gene for this product maps to a region on chromosome 7 identified as an autism-susceptibility locus. Mutation screening of the entire coding region in autistic individuals failed to identify phenotype-specific variants, suggesting that coding mutations for this gene are unlikely to be involved in the etiology of autism. The function of this gene product has not been determined. Transcript variants encoding different isoforms of this protein have been described.

Synonyms: ETS7q | FAM4A | FAM4A1 | HELG | RAY1 | SEN4 | ST7 | TSG7 | Q9NRC1

Gen-ID: 7982