Peptide YY Antikörper (Middle Region)
-
- Target Alle Peptide YY (PYY) Antikörper anzeigen
- Peptide YY (PYY)
-
Bindungsspezifität
- AA 29-64, Middle Region
-
Reaktivität
- Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Peptide YY Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Peptide YY(PYY) detection. Tested with WB in Mouse.
- Sequenz
- YPAKPEAPGE DASPEELSRY YASLRHYLNL VTRQRY
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Peptide YY(PYY) detection. Tested with WB in Mouse.
Gene Name: peptide YY
Protein Name: Peptide YY - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of mouse Peptide YY (29-64aa YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY), different from the related human sequence by three amino acids, and identical to the related rat sequence.
- Isotyp
- IgG
- Top Product
- Discover our top product PYY Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- Peptide YY (PYY)
- Andere Bezeichnung
- PYY (PYY Produkte)
- Synonyme
- PYY-I antikoerper, PYY1 antikoerper, GHYY antikoerper, RATGHYY antikoerper, Yy antikoerper, peptide-YY antikoerper, peptide YY antikoerper, peptide YY (mapped) antikoerper, PYY antikoerper, Pyy antikoerper
- Hintergrund
-
Peptide YY (PYY), also known as peptide tyrosine tyrosine, is a peptide that in humans is encoded by the PYY gene. This gene encodes a member of the neuropeptide Y (NPY) family of peptides. The encoded preproprotein is proteolytically processed to generate two alternative peptide products that differ in length by three amino acids. These peptides, secreted by endocrine cells in the gut, exhibit different binding affinities for each of the neuropeptide Y receptors. Binding of the encoded peptides to these receptors mediates regulation of pancreatic secretion, gut mobility and energy homeostasis. Rare variations in this gene could increase susceptibility to obesity and elevated serum levels of the encoded peptides may be associated with anorexia nervosa.
Synonyms: GHYY | peptide YY | PYY 1 | PYY I | PYYI | PYY | PYY II | PYY-II | RATGHYY | Yy | Q9EPS2 - Gen-ID
- 217212
-