PSMA4 Antikörper (Middle Region)
-
- Target Alle PSMA4 Antikörper anzeigen
- PSMA4 (Proteasome Subunit alpha 4 (PSMA4))
-
Bindungsspezifität
- AA 84-123, Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PSMA4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Proteasome subunit alpha type-4(PSMA4) detection. Tested with WB in Human,Mouse,Rat.
- Sequenz
- NVLTNELRLI AQRYLLQYQE PIPCEQLVTA LCDIKQAYTQ
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Proteasome subunit alpha type-4(PSMA4) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: proteasome subunit alpha 4
Protein Name: Proteasome subunit alpha type-4 - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human PSMA4 (84-123aa NVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQ), identical to the related mouse and rat sequences.
- Isotyp
- IgG
- Top Product
- Discover our top product PSMA4 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- PSMA4 (Proteasome Subunit alpha 4 (PSMA4))
- Andere Bezeichnung
- PSMA4 (PSMA4 Produkte)
- Synonyme
- wu:fe05d10 antikoerper, zgc:56176 antikoerper, DDBDRAFT_0204055 antikoerper, DDBDRAFT_0214953 antikoerper, DDB_0204055 antikoerper, DDB_0214953 antikoerper, C9 antikoerper, HC9 antikoerper, HsT17706 antikoerper, PSC9 antikoerper, proteasome subunit alpha 4 antikoerper, proteasome subunit alpha 4 S homeolog antikoerper, proteasome subunit alpha type 4 antikoerper, 20S proteasome subunit alpha-4 antikoerper, proteasome (prosome, macropain) subunit, alpha type 4 antikoerper, psma4 antikoerper, psma4.S antikoerper, PSMA4 antikoerper, CNF01860 antikoerper, psmA4 antikoerper, Psma4 antikoerper
- Hintergrund
-
Proteasome subunit alpha type-4, also known as macropain subunit C9, proteasome component C9, and 20S proteasome subunit alpha-3, is a protein that in humans is encoded by the PSMA4 gene. The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits, 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Three alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Synonyms: HC9 | Macropain subunit C9 | PSC9 | PSMA 4 | psmA4 | P25789 - Gen-ID
- 5685
- UniProt
- P25789
- Pathways
- Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA
-