PSMA4 Antikörper (Middle Region)

Produktnummer ABIN4886707

Produktdetails anti-PSMA4 Antikörper

Target: PSMA4 (Proteasome Subunit alpha 4 (PSMA4))

Bindungsspezifität: AA 84-123, Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PSMA4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Proteasome subunit alpha type-4(PSMA4) detection. Tested with WB in Human,Mouse,Rat.

Sequenz: NVLTNELRLI AQRYLLQYQE PIPCEQLVTA LCDIKQAYTQ

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Proteasome subunit alpha type-4(PSMA4) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: proteasome subunit alpha 4
Protein Name: Proteasome subunit alpha type-4

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human PSMA4 (84-123aa NVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQ), identical to the related mouse and rat sequences.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu PSMA4

Target: PSMA4 (Proteasome Subunit alpha 4 (PSMA4))

Andere Bezeichnung: PSMA4 (PSMA4 Produkte)

Hintergrund: Proteasome subunit alpha type-4, also known as macropain subunit C9, proteasome component C9, and 20S proteasome subunit alpha-3, is a protein that in humans is encoded by the PSMA4 gene. The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits, 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Three alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Synonyms: HC9 | Macropain subunit C9 | PSC9 | PSMA 4 | psmA4 | P25789

Gen-ID: 5685

UniProt: P25789

Pathways: Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA