MMP13 Antikörper (N-Term)
-
- Target Alle MMP13 Antikörper anzeigen
- MMP13 (Matrix Metallopeptidase 13 (Collagenase 3) (MMP13))
-
Bindungsspezifität
- AA 109-154, N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MMP13 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Collagenase 3 (MMP13) detection. Tested with WB in Human.
- Sequenz
- RTLKWSKMNL TYRIVNYTPD MTHSEVEKAF KKAFKVWSDV TPLNFT
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Collagenase 3 (MMP13) detection. Tested with WB in Human.
Gene Name: matrix metallopeptidase 13
Protein Name: Collagenase 3 - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human MMP13 (109-154aa RTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFT), different from the related mouse sequence by four amino acids, and from the related rat sequence by five amino acids.
- Isotyp
- IgG
- Top Product
- Discover our top product MMP13 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
-
Protective effects of tumor necrosis factor-α blockade by adalimumab on articular cartilage and subchondral bone in a rat model of osteoarthritis." in: Brazilian journal of medical and biological research = Revista brasileira de pesquisas medicas e biologicas, Vol. 48, Issue 10, pp. 863-70, (2016) (PubMed).
: "Protective effect of calcitonin on lumbar fusion-induced adjacent-segment disc degeneration in ovariectomized rat." in: BMC musculoskeletal disorders, Vol. 16, pp. 342, (2016) (PubMed).
: "Effects of ultrasound on estradiol level, bone mineral density, bone biomechanics and matrix metalloproteinase-13 expression in ovariectomized rabbits." in: Experimental and therapeutic medicine, Vol. 10, Issue 4, pp. 1429-1436, (2015) (PubMed).
: "The effect of electroacupuncture on the extracellular matrix synthesis and degradation in a rabbit model of disc degeneration." in: Evidence-based complementary and alternative medicine : eCAM, Vol. 2014, pp. 731395, (2014) (PubMed).
: "
-
Protective effects of tumor necrosis factor-α blockade by adalimumab on articular cartilage and subchondral bone in a rat model of osteoarthritis." in: Brazilian journal of medical and biological research = Revista brasileira de pesquisas medicas e biologicas, Vol. 48, Issue 10, pp. 863-70, (2016) (PubMed).
-
- Target
- MMP13 (Matrix Metallopeptidase 13 (Collagenase 3) (MMP13))
- Andere Bezeichnung
- MMP13 (MMP13 Produkte)
- Synonyme
- CLG3 antikoerper, MANDP1 antikoerper, Clg antikoerper, MMP-13 antikoerper, Mmp1 antikoerper, cb1034 antikoerper, mmp13 antikoerper, gene A antikoerper, xCol antikoerper, xcl3 antikoerper, MMP13 antikoerper, MGC108008 antikoerper, matrix metallopeptidase 13 antikoerper, matrix metallopeptidase 13a antikoerper, matrix metallopeptidase 13 (collagenase 3) like S homeolog antikoerper, matrix metallopeptidase 13 (collagenase 3) antikoerper, matrix metalloproteinase 13 antikoerper, matrix metallopeptidase 13 (collagenase 3) like L homeolog antikoerper, MMP13 antikoerper, Mmp13 antikoerper, mmp13a antikoerper, mmp13l.S antikoerper, mmp13 antikoerper, LOC100136348 antikoerper, mmp13l.L antikoerper
- Hintergrund
-
Collagenase 3 is an enzyme that in humans is encoded by the MMP13 gene. This gene encodes a member of the peptidase M10 family of matrix metalloproteinases (MMPs). Proteins in this family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. The encoded preproprotein is proteolytically processed to generate the mature protease. This protease cleaves type II collagen more efficiently than types I and III. It may be involved in articular cartilage turnover and cartilage pathophysiology associated with osteoarthritis. Mutations in this gene are associated with metaphyseal anadysplasia. This gene is part of a cluster of MMP genes on chromosome 11.
Synonyms: CLG 3 | CLG3 | Collagenase 3 | Collagenase3 | MANDP1 | MDST | MMP13 | MMP-13 | MMP 13 | P45452 - Gen-ID
- 4322
- UniProt
- P45452
-