Cytokeratin 5 Antikörper (Middle Region)

Produktnummer ABIN4886654

Produktdetails anti-Cytokeratin 5 Antikörper

Target: Cytokeratin 5 (KRT5) (Keratin 5 (KRT5))

Bindungsspezifität: AA 286-317, Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Cytokeratin 5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for Keratin, type II cytoskeletal 5(KRT5) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequenz: KVELEAKVDA LMDEINFMKM FFDAELSQMQ TH

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Keratin, type II cytoskeletal 5(KRT5) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: keratin 5
Protein Name: Keratin, type II cytoskeletal 5

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Cytokeratin 5 (286-317aa KVELEAKVDALMDEINFMKMFFDAELSQMQTH), different from the related mouse sequence by one amino acid, and identical to the related rat sequence.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu Cytokeratin 5

Target: Cytokeratin 5 (KRT5) (Keratin 5 (KRT5))

Andere Bezeichnung: KRT5 (KRT5 Produkte)

Synonyme: 3300001P10Rik antikoerper, AW146334 antikoerper, CK5 antikoerper, K5 antikoerper, Krt2-5 antikoerper, Tfip8 antikoerper, DDD antikoerper, DDD1 antikoerper, EBS2 antikoerper, KRT5A antikoerper, Sak57 antikoerper, ckii antikoerper, wu:fb02h09 antikoerper, wu:fj02d02 antikoerper, wu:fk78b12 antikoerper, zfCKII antikoerper, KRT75 antikoerper, CK-5 antikoerper, Keratin-5 antikoerper, keratin 5 antikoerper, Krt5 antikoerper, KRT5 antikoerper, krt5 antikoerper

Hintergrund: Cytokeratin 5, also known as KRT5, K5, or CK5, is a protein that is encoded in humans by the KRT5 gene. The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is specifically expressed in the basal layer of the epidermis with family member KRT14. Mutations in these genes have been associated with a complex of diseases termed epidermolysis bullosa simplex. The type II cytokeratins are clustered in a region of chromosome 12q12-q13.

Synonyms: CK-5 | CK5 | Cytokeratin-5 | Cytokeratin5 | DDD | DDD1 | EBS2 | K5 | Keratin 5 | Keratin | Keratin-5 | Keratin5 | KRT 5 | Krt5 | KRT5A | P13647

Gen-ID: 3852

UniProt: P13647