HNRNPH1 Antikörper (N-Term)

Produktnummer ABIN4886623

Produktdetails anti-HNRNPH1 Antikörper

Target: HNRNPH1 (Heterogeneous Nuclear Ribonucleoprotein H1 (H) (HNRNPH1))

Bindungsspezifität: AA 23-52, N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HNRNPH1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Heterogeneous nuclear ribonucleoprotein H (HNRNPH1) detection. Tested with WB in Human.

Sequenz: SADEVQRFFS DCKIQNGAQG IRFIYTREGR

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Heterogeneous nuclear ribonucleoprotein H (HNRNPH1) detection. Tested with WB in Human.
Gene Name: heterogeneous nuclear ribonucleoprotein H1 (H)
Protein Name: Heterogeneous nuclear ribonucleoprotein H

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human HnRNP H (23-52aa SADEVQRFFSDCKIQNGAQGIRFIYTREGR), identical to the related mouse and rat sequences.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu HNRNPH1

Target: HNRNPH1 (Heterogeneous Nuclear Ribonucleoprotein H1 (H) (HNRNPH1))

Andere Bezeichnung: HNRNPH1 (HNRNPH1 Produkte)

Hintergrund: Heterogeneous nuclear ribonucleoprotein H is a protein that in humans is encoded by the HNRNPH1 gene. This gene encodes a member of a subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins that complex with heterogeneous nuclear RNA. These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some may shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has three repeats of quasi-RRM domains that bind to RNA and is very similar to the family member HNRPF. This gene may be associated with hereditary lymphedema type I. Alternatively spliced transcript variants have been described.

Synonyms: hnRNP H | hnRNPH | Hnrnph1 | HNRPH 1 | HNRPH | HNRPH1 protein | P31943

Gen-ID: 3187

UniProt: P31943