EPHX2 Antikörper (C-Term)
-
- Target Alle EPHX2 Antikörper anzeigen
- EPHX2 (Epoxide Hydrolase 2, Cytoplasmic (EPHX2))
-
Bindungsspezifität
- AA 505-543, C-Term
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser EPHX2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Bifunctional epoxide hydrolase 2(EPHX2) detection. Tested with WB in Human,Mouse,Rat.
- Sequenz
- QHMEDWIPHL KRGHIEDCGH WTQMDKPTEV NQILIKWLD
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Bifunctional epoxide hydrolase 2(EPHX2) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: epoxide hydrolase 2
Protein Name: Bifunctional epoxide hydrolase 2 - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human EPHX2 (505-543aa QHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIKWLD), different from the related mouse sequence by seven amino acids, and from the related rat sequence by eight amino acids.
- Isotyp
- IgG
- Top Product
- Discover our top product EPHX2 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- EPHX2 (Epoxide Hydrolase 2, Cytoplasmic (EPHX2))
- Andere Bezeichnung
- EPHX2 (EPHX2 Produkte)
- Synonyme
- CEH antikoerper, SEH antikoerper, Eph2 antikoerper, sEP antikoerper, epoxide hydrolase 2 antikoerper, soluble epoxide hydrolase antikoerper, Soluble epoxide hydrolase antikoerper, alpha/beta hydrolase antikoerper, epoxide hydrolase 2, cytoplasmic antikoerper, EPHX2 antikoerper, SEH2 antikoerper, PTRG_01276 antikoerper, Deima_0402 antikoerper, Deipr_0144 antikoerper, Psed_0418 antikoerper, Fluta_3767 antikoerper, HALXA_RS12710 antikoerper, Ephx2 antikoerper
- Hintergrund
-
Soluble epoxide hydrolase (sEH) is a bifunctional enzyme that in humans is encoded by the EPHX2 gene. It is mapped to 8p21.2-p21.1. This gene encodes a member of the epoxide hydrolase family. The protein, found in both the cytosol and peroxisomes, binds to specific epoxides and converts them to the corresponding dihydrodiols. Mutations in this gene have been associated with familial hypercholesterolemia. Alternatively spliced transcript variants have been described.
Synonyms: CEH | EPHX2 | SEH | P34913 - Gen-ID
- 2053
- UniProt
- P34913
-