DDAH1 Antikörper (C-Term)

Produktnummer ABIN4886560

Produktdetails anti-DDAH1 Antikörper

Target: DDAH1 (Dimethylarginine Dimethylaminohydrolase 1 (DDAH1))

Bindungsspezifität: AA 195-226, C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DDAH1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for N(G),N(G)-dimethylarginine dimethylaminohydrolase 1(DDAH1) detection. Tested with WB in Human,Mouse,Rat.

Sequenz: QKALKIMQQM SDHRYDKLTV PDDIAANCIY LN

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for N(G),N(G)-dimethylarginine dimethylaminohydrolase 1(DDAH1) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: dimethylarginine dimethylaminohydrolase 1
Protein Name: N(G),N(G)-dimethylarginine dimethylaminohydrolase 1

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human DDAH1 (195-226aa QKALKIMQQMSDHRYDKLTVPDDIAANCIYLN), different from the related mouse and rat sequences by one amino acid.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu DDAH1

Target: DDAH1 (Dimethylarginine Dimethylaminohydrolase 1 (DDAH1))

Andere Bezeichnung: DDAH1 (DDAH1 Produkte)

Synonyme: DDAH antikoerper, 2410006N07Rik antikoerper, 2510015N06Rik antikoerper, AI987801 antikoerper, AW050362 antikoerper, DDAH1 antikoerper, wu:fc30c11 antikoerper, zgc:85829 antikoerper, dimethylarginine dimethylaminohydrolase 1 antikoerper, dimethylarginine dimethylaminohydrolase 1 L homeolog antikoerper, DDAH1 antikoerper, Ddah1 antikoerper, ddah1.L antikoerper, ddah1 antikoerper

Hintergrund: DDAH1 is knowns as dimethylarginine dimethylaminohydrolase 1 which is mapped to chromosome 1p22 by radiation hybrid and FISH analysis. This gene belongs to the dimethylarginine dimethylaminohydrolase (DDAH) gene family. DDAH1 plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity. It widely expressed, especially in liver and kidney.

Synonyms: DDAH 1 | DDAH1 | DDAH | Dimethylargininase-1 | Dimethylargininase 1 | O94760

Gen-ID: 23576

UniProt: O94760