CPM Antikörper (C-Term)

Produktnummer ABIN4886547

Produktdetails anti-CPM Antikörper

Target: CPM (Carboxypeptidase M (CPM))

Bindungsspezifität: AA 286-316, C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CPM Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Carboxypeptidase M(CPM) detection. Tested with WB in Human.

Sequenz: KYPREEKLPS FWNNNKASLI EYIKQVHLGV K

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Carboxypeptidase M(CPM) detection. Tested with WB in Human.
Gene Name: carboxypeptidase M
Protein Name: Carboxypeptidase M

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human CPM (286-316aa KYPREEKLPSFWNNNKASLIEYIKQVHLGVK), different from the related mouse sequence by two amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu CPM

Target: CPM (Carboxypeptidase M (CPM))

Andere Bezeichnung: CPM (CPM Produkte)

Synonyme: im:7143022 antikoerper, im:7143022l antikoerper, si:dkey-11p6.1 antikoerper, zgc:110307 antikoerper, CPM antikoerper, 1110060I01Rik antikoerper, 5730456K23Rik antikoerper, AA589379 antikoerper, E030045M14Rik antikoerper, carboxypeptidase M antikoerper, carboxypeptidase D antikoerper, CPM antikoerper, cpm antikoerper, LOC5574253 antikoerper, Cpm antikoerper

Hintergrund: CPM, mapped to 12q15, is known as Carboxypeptidase M. The protein encoded by this gene is a membrane-bound arginine/lysine carboxypeptidase. Its expression is associated with monocyte to macrophage differentiation. This encoded protein contains hydrophobic regions at the amino and carboxy termini and has 6 potential asparagine-linked glycosylation sites. The active site residues of carboxypeptidases A and B are conserved in this protein. Three alternatively spliced transcript variants encoding the same protein have been described for this gene.

Synonyms: Carboxypeptidase M | CPM | Renal carboxypeptidase | Urinary carboxypeptidase B | P14384

Gen-ID: 1368

UniProt: P14384