CPM Antikörper (C-Term)
-
- Target Alle CPM Antikörper anzeigen
- CPM (Carboxypeptidase M (CPM))
-
Bindungsspezifität
- AA 286-316, C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CPM Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Carboxypeptidase M(CPM) detection. Tested with WB in Human.
- Sequenz
- KYPREEKLPS FWNNNKASLI EYIKQVHLGV K
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Carboxypeptidase M(CPM) detection. Tested with WB in Human.
Gene Name: carboxypeptidase M
Protein Name: Carboxypeptidase M - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human CPM (286-316aa KYPREEKLPSFWNNNKASLIEYIKQVHLGVK), different from the related mouse sequence by two amino acids.
- Isotyp
- IgG
- Top Product
- Discover our top product CPM Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- CPM (Carboxypeptidase M (CPM))
- Andere Bezeichnung
- CPM (CPM Produkte)
- Hintergrund
-
CPM, mapped to 12q15, is known as Carboxypeptidase M. The protein encoded by this gene is a membrane-bound arginine/lysine carboxypeptidase. Its expression is associated with monocyte to macrophage differentiation. This encoded protein contains hydrophobic regions at the amino and carboxy termini and has 6 potential asparagine-linked glycosylation sites. The active site residues of carboxypeptidases A and B are conserved in this protein. Three alternatively spliced transcript variants encoding the same protein have been described for this gene.
Synonyms: Carboxypeptidase M | CPM | Renal carboxypeptidase | Urinary carboxypeptidase B | P14384 - Gen-ID
- 1368
- UniProt
- P14384
-