Cnpase Antikörper (Middle Region)

Produktnummer ABIN4886542

Produktdetails anti-Cnpase Antikörper

Target: Cnpase (CNP) (2',3'-Cyclic Nucleotide 3' phosphodiesterase (CNP))

Bindungsspezifität: AA 142-178, Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Cnpase Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for 2',3'-cyclic-nucleotide 3'-phosphodiesterase(CNP) detection. Tested with WB in Human,Mouse,Rat.

Sequenz: QYQVVLVEPK TAWRLDCAQL KEKNQWQLSA DDLKKLK

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for 2',3'-cyclic-nucleotide 3'-phosphodiesterase(CNP) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: 2',3'-cyclic nucleotide 3' phosphodiesterase
Protein Name: 2',3'-cyclic-nucleotide 3'-phosphodiesterase

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human CNPase (142-178aa QYQVVLVEPKTAWRLDCAQLKEKNQWQLSADDLKKLK), identical to the related mouse sequence, and different from the related rat sequence by one amino acid.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Referenzen für anti-Cnpase Antikörper (ABIN4886542)

Cai, Ma, Li, Tian, Li: "Catalpol Protects Pre-Myelinating Oligodendrocytes against Ischemia-induced Oxidative Injury through ERK1/2 Signaling Pathway." in: International journal of biological sciences, Vol. 12, Issue 12, pp. 1415-1426, (2017) (PubMed).

Details zu Cnpase

Target: Cnpase (CNP) (2',3'-Cyclic Nucleotide 3' phosphodiesterase (CNP))

Andere Bezeichnung: CNP (CNP Produkte)

Synonyme: CNP1 antikoerper, CNPase antikoerper, Cnp-1 antikoerper, Cnp1 antikoerper, CNPF antikoerper, CNPI antikoerper, CNPII antikoerper, CNP antikoerper, DKFZp469F1421 antikoerper, cnpl antikoerper, fd21d08 antikoerper, fi37a10 antikoerper, rich antikoerper, sb:cb662 antikoerper, si:ch73-158e11.4 antikoerper, wu:fd21d08 antikoerper, wu:fd44a05 antikoerper, wu:fi35d08 antikoerper, wu:fi37a10 antikoerper, cnp antikoerper, 2',3'-cyclic nucleotide 3' phosphodiesterase antikoerper, CNP antikoerper, Cnp antikoerper, cnp antikoerper, cnp.L antikoerper

Hintergrund: 2',3'-Cyclic-nucleotide 3'-phosphodiesterase, also known as CNPase, is an enzyme that in humans is encoded by the CNP gene. And this gene is mapped to 17q21.2. CNPase is named for its ability to catalyze the phosphodiester hydrolysis of 2',3'-cyclic nucleotides to 2'-nucleotides. CNPase is thought to play a critical role in the events leading up to myelination. Additionally, CNPase has been demonstrated to inhibit the replication of HIV-1 and other primate lentiviruses by binding the retroviral Gag protein and inhibiting the genesis of nascent viral particles.

Synonyms: CNP 1 | CNP1 | CNP | CNPase | P09543

Gen-ID: 1267

UniProt: P09543