CCDC6 Antikörper (N-Term)

Produktnummer ABIN4886506

Produktdetails anti-CCDC6 Antikörper

Target: CCDC6 (Coiled-Coil Domain Containing 6 (CCDC6))

Bindungsspezifität: AA 156-198, N-Term

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CCDC6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Coiled-coil domain-containing protein 6(CCDC6) detection. Tested with WB in Human,Rat.

Sequenz: KAELEQHLEQ EQEFQVNKLM KKIKKLENDT ISKQLTLEQL RR

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Coiled-coil domain-containing protein 6(CCDC6) detection. Tested with WB in Human,Rat.
Gene Name: coiled-coil domain containing 6
Protein Name: Coiled-coil domain-containing protein 6

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human CCDC6 (156-198aa KAELEQHLEQEQEFQVNKLMKKIKKLENDTISKQLTLEQLRR E), identical to the related mouse sequence.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu CCDC6

Target: CCDC6 (Coiled-Coil Domain Containing 6 (CCDC6))

Andere Bezeichnung: CCDC6 (CCDC6 Produkte)

Synonyme: ccdc6 antikoerper, fj36e04 antikoerper, zgc:56563 antikoerper, zgc:77435 antikoerper, wu:fj36e04 antikoerper, MGC53501 antikoerper, D10S170 antikoerper, H4 antikoerper, PTC antikoerper, TPC antikoerper, TST1 antikoerper, 2810012H18Rik antikoerper, AA536681 antikoerper, AA960498 antikoerper, AW061011 antikoerper, coiled-coil domain containing 6a antikoerper, coiled-coil domain containing 6 S homeolog antikoerper, coiled-coil domain containing 6 antikoerper, ccdc6a antikoerper, ccdc6.S antikoerper, CCDC6 antikoerper, Ccdc6 antikoerper

Hintergrund: Coiled-coil domain-containing protein 6 is a protein that in humans is encoded by the CCDC6 gene. This gene encodes a coiled-coil domain-containing protein. The encoded protein is ubiquitously expressed and may function as a tumor suppressor. A chromosomal rearrangement resulting in the expression of a fusion gene containing a portion of this gene and the intracellular kinase-encoding domain of the ret proto-oncogene is the cause of thyroid papillary carcinoma.

Synonyms: CCDC 6 | CCDC6 | D10S170 | H4 | Protein H4 | PTC | TPC | TST1 | TST 1 | Q16204

Gen-ID: 8030

UniProt: Q16204