CCDC6 Antikörper (N-Term)
-
- Target Alle CCDC6 Antikörper anzeigen
- CCDC6 (Coiled-Coil Domain Containing 6 (CCDC6))
-
Bindungsspezifität
- AA 156-198, N-Term
-
Reaktivität
- Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CCDC6 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Coiled-coil domain-containing protein 6(CCDC6) detection. Tested with WB in Human,Rat.
- Sequenz
- KAELEQHLEQ EQEFQVNKLM KKIKKLENDT ISKQLTLEQL RR
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Coiled-coil domain-containing protein 6(CCDC6) detection. Tested with WB in Human,Rat.
Gene Name: coiled-coil domain containing 6
Protein Name: Coiled-coil domain-containing protein 6 - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human CCDC6 (156-198aa KAELEQHLEQEQEFQVNKLMKKIKKLENDTISKQLTLEQLRR E), identical to the related mouse sequence.
- Isotyp
- IgG
- Top Product
- Discover our top product CCDC6 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- CCDC6 (Coiled-Coil Domain Containing 6 (CCDC6))
- Andere Bezeichnung
- CCDC6 (CCDC6 Produkte)
- Synonyme
- ccdc6 antikoerper, fj36e04 antikoerper, zgc:56563 antikoerper, zgc:77435 antikoerper, wu:fj36e04 antikoerper, MGC53501 antikoerper, D10S170 antikoerper, H4 antikoerper, PTC antikoerper, TPC antikoerper, TST1 antikoerper, 2810012H18Rik antikoerper, AA536681 antikoerper, AA960498 antikoerper, AW061011 antikoerper, coiled-coil domain containing 6a antikoerper, coiled-coil domain containing 6 S homeolog antikoerper, coiled-coil domain containing 6 antikoerper, ccdc6a antikoerper, ccdc6.S antikoerper, CCDC6 antikoerper, Ccdc6 antikoerper
- Hintergrund
-
Coiled-coil domain-containing protein 6 is a protein that in humans is encoded by the CCDC6 gene. This gene encodes a coiled-coil domain-containing protein. The encoded protein is ubiquitously expressed and may function as a tumor suppressor. A chromosomal rearrangement resulting in the expression of a fusion gene containing a portion of this gene and the intracellular kinase-encoding domain of the ret proto-oncogene is the cause of thyroid papillary carcinoma.
Synonyms: CCDC 6 | CCDC6 | D10S170 | H4 | Protein H4 | PTC | TPC | TST1 | TST 1 | Q16204 - Gen-ID
- 8030
- UniProt
- Q16204
-