BDKRB2 Antikörper (C-Term)

Produktnummer ABIN4886484

Produktdetails anti-BDKRB2 Antikörper

Target: BDKRB2 (Bradykinin Receptor B2 (BDKRB2))

Bindungsspezifität: AA 357-391, C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser BDKRB2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for B2 bradykinin receptor(BDKRB2) detection. Tested with WB in Human.

Sequenz: RSEPIQMENS MGTLRTSISV ERQIHKLQDW AGSRQ

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for B2 bradykinin receptor(BDKRB2) detection. Tested with WB in Human.
Gene Name: bradykinin receptor B2
Protein Name: B2 bradykinin receptor

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human BDKRB2 (357-391aa RSEPIQMENSMGTLRTSISVERQIHKLQDWAGSRQ), different from the related mouse sequence by five amino acids, and from the related rat sequence by seven amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu BDKRB2

Target: BDKRB2 (Bradykinin Receptor B2 (BDKRB2))

Andere Bezeichnung: BDKRB2 (BDKRB2 Produkte)

Synonyme: BDKRB2 antikoerper, b2r antikoerper, bk2 antikoerper, bk-2 antikoerper, bkr2 antikoerper, brb2 antikoerper, kinrec antikoerper, B2R antikoerper, BK-2 antikoerper, BK2 antikoerper, BKR2 antikoerper, BRB2 antikoerper, B2BKR antikoerper, B2BRA antikoerper, B(2) antikoerper, B2 antikoerper, BK2R antikoerper, Bdkrb2 antikoerper, bradykinin receptor B2 antikoerper, bradykinin receptor, beta 2 antikoerper, bradykinin type 2 receptor antikoerper, Bdkrb2 antikoerper, BDKRB2 antikoerper, bdkrb2 antikoerper, kinrec antikoerper, B2R antikoerper

Hintergrund: Bradykinin receptor B2 is a G-protein coupled receptor forbradykinin, encoded by the BDKRB2 gene in humans. This gene encodes a receptor for bradykinin. The 9 aa bradykinin peptide elicits many responses including vasodilation, edema, smooth muscle spasm and pain fiber stimulation. This receptor associates with G proteins that stimulate a phosphatidylinositol-calcium second messenger system. Alternate start codons result in two isoforms of the protein.

Synonyms: B2 | B2BKR | B2BRA | B2R | BDKR B2 | BDKRB 2 | BDKRB2 | BK 2 | BK 2 receptor | BK R2 | BK-2 receptor | BK2 | BK2 receptor | BK2R | BKR 2 | BKR2 | BR B2 | BRB 2 | BRB2 | Kinin B2 | P30411

Gen-ID: 624

UniProt: P30411

Pathways: ACE Inhibitor Pathway, Negative Regulation of intrinsic apoptotic Signaling