Adenylate Kinase 1 Antikörper (C-Term)

Produktnummer ABIN4886445

Produktdetails anti-Adenylate Kinase 1 Antikörper

Target: Adenylate Kinase 1 (AK1)

Bindungsspezifität: AA 149-189, C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Adenylate Kinase 1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Adenylate kinase isoenzyme 1(AK1) detection. Tested with WB in Human,Mouse,Rat.

Sequenz: RLETYYKATE PVIAFYEKRG IVRKVNAEGS VDSVF

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Adenylate kinase isoenzyme 1(AK1) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: adenylate kinase 1
Protein Name: Adenylate kinase isoenzyme 1

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Adenylate Kinase 1 (149-189aa RLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVF SQVCTH), different from the related mouse sequence by seven amino acids, and from the related rat sequence by four amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu Adenylate Kinase 1

Target: Adenylate Kinase 1 (AK1)

Andere Bezeichnung: AK1 (AK1 Produkte)

Synonyme: ADK-1 antikoerper, AK1 antikoerper, CG17146 antikoerper, DAK1 antikoerper, Dak1 antikoerper, Dmel\\CG17146 antikoerper, adk1 antikoerper, bs34e10.y1 antikoerper, ak5 antikoerper, ADENYLATE KINASE 1 antikoerper, MLE2.3 antikoerper, MLE2_3 antikoerper, adenylate kinase 1 antikoerper, Ak-1 antikoerper, B430205N08Rik antikoerper, Ak 1 antikoerper, zgc:91930 antikoerper, Myokinase antikoerper, Adenylate kinase 1 antikoerper, adenylate kinase 1 antikoerper, Adk1 antikoerper, ak1 antikoerper, AK1 antikoerper, ADK1 antikoerper, Ak1 antikoerper

Hintergrund: This gene encodes an adenylate kinase enzyme involved in energy metabolism and homeostasis of cellular adenine nucleotide ratios in different intracellular compartments. This gene is highly expressed in skeletal muscle, brain and erythrocytes. Certain mutations in this gene resulting in a functionally inadequate enzyme are associated with a rare genetic disorder causing nonspherocytic hemolytic anemia. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms.

Synonyms: Adenylate kinase 1 | AK 1 | AK1 | ATP-AMP transphosphorylase 1 | KAD1 | Myokinase | P00568

Gen-ID: 203

UniProt: P00568

Pathways: Nucleotide Phosphorylation, Ribonucleoside Biosynthetic Process