IL22RA2 Antikörper (AA 33-60)

Produktnummer ABIN342774

Produktdetails anti-IL22RA2 Antikörper

Target: IL22RA2 (Interleukin 22 Receptor, alpha 2 (IL22RA2))

Bindungsspezifität: AA 33-60

Reaktivität: Human, Affe

Wirt: Ziege

Klonalität: Polyklonal

Konjugat: Dieser IL22RA2 Antikörper ist unkonjugiert

Applikation: ELISA

Spezifität: This antibody recognizes the N-terminus region of human interleukin-22 receptor alpha-2 chain precursor (IL-22R-alpha-2) which is also known as IL-22-binding protein (IL22BP), cytokine receptor family class II member 10 (CRF2-10), and cytokine receptor family type 2, soluble 1 (CRF2-S1). This antibody is likely to recognize rat and mouse IL-22 RA2 protein due to sequence similarity. The peptide sequence is <50 % identical to other sequences in GenBank.

Homologie: Percent identity by BLAST analysis: Human, Gorilla, Monkey (100%) Gibbon (96%) Marmoset (89%) Dog (82%).

Aufreinigung: Immunoaffinity purified

Immunogen: Synthetic peptide RVQFQSRNFHNILQWQPGRALTGNSSVY-C corresponding to 33-60 residues of N-terminus of human IL-22R-alpha-2 protein with cysteine added for conjugation to a carrier protein. Percent identity by BLAST analysis: Human, Gorilla, Monkey (100%), Gibbon (96%), Marmoset (89%), Dog (82%).

Type of Immunogen: Synthetic peptide

Anwendungsinformationen

Applikationshinweise: Approved: ELISA (1:50000)

Usage: ELISA: Peptide-based assay to confirm the ability of the antibody to recognize the immunogenic peptide.

Not recommended for: IHC-P

Kommentare:

Target Species of Antibody: Human

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Liquid

Konzentration: Lot specific

Buffer: 10  mM KHPO4, 140  mM NaCl, BSA, 0.1 % sodium azide

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Aliquot to Avoid freeze/thaw cycles.

Lagerung: -20 °C

Informationen zur Lagerung: Store at -20°C. Aliquot to avoid freeze/thaw cycles.

Details zu IL22RA2

Target: IL22RA2 (Interleukin 22 Receptor, alpha 2 (IL22RA2))

Andere Bezeichnung: IL-22BP / IL22RA2 (IL22RA2 Produkte)

Synonyme: CRF2-10 antikoerper, CRF2-S1 antikoerper, CRF2X antikoerper, IL-22BP antikoerper, IL-22R-alpha-2 antikoerper, IL-22RA2 antikoerper, ZCYTOR16 antikoerper, CRF2-s1 antikoerper, Il-22bp antikoerper, Crf2-s1 antikoerper, interleukin 22 receptor subunit alpha 2 antikoerper, interleukin 22 receptor, alpha 2 antikoerper, IL22RA2 antikoerper, Il22ra2 antikoerper

Hintergrund: Name/Gene ID: IL22RA2

Synonyms: IL22RA2, Class II cytokine receptor, IL-22BP, IL-22RA2, IL-22R-alpha-2, Interleukin 22-binding protein, Interleukin-22-binding protein, CRF2-10, CRF2-S1, CRF2X, IL-22 receptor subunit alpha-2, IL22BP, ZcytoR16

Gen-ID: 116379

UniProt: Q969J5