Integrin alpha 3B, alpha 6B Antikörper

Produktnummer ABIN335348

Es gibt 1 Publikation für dieses Produkt. Der Maus Monoklonal anti-Integrin alpha 3B, alpha 6B Antikörper wird verwendet zum Nachweis von Integrin alpha 3B, alpha 6B in Proben von Human. Er wurde validiert für ICC, IHC (fro), IHC und WB.

Kurzübersicht für Integrin alpha 3B, alpha 6B Antikörper (ABIN335348)

Target: Integrin alpha 3B, alpha 6B

Reaktivität: Human

Wirt: Maus

Klonalität: Monoklonal

Applikation: Immunocytochemistry (ICC), Immunohistochemistry (Frozen Sections) (IHC (fro)), Immunohistochemistry (IHC), Western Blotting (WB)

Klon: PB36

Produktdetails

Spezifität: Human. A broad species reactivity is expected because of the conserved nature of the epitope.

Aufreinigung: Purified

Immunogen: PB36 is a mouse monoclonal IgG1, kappa antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with a synthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of integrin alpha3B including an appending N-terminal cysteine (CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK) coupled to keyhole limpet hemocyanin.

Isotyp: IgG1

Anwendungsinformationen

Applikationshinweise: PB36 recognizes the cytoplasmic domain of integrin subunits alpha3B and alpha6B. PB36 reacts with the basement membrane zone and endothelial cells in skin, tubuli in kidney and all vascular and capillary endothelia in brain and heart. PB36 is suitable for immunoblotting, immunocytochemistry and immunohistochemistry on frozen tissues. Optimal antibody dilution should be determined by titration, recommended range is 1:50 - 1:100 for immunohistochemistry with avidin-biotinylated horseradish peroxidase complex (ABC) as detection reagent, and 1:100 - 1:500 for immunoblotting applications.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Lagerung: 4 °C

Referenzen

de Melker, Sterk, Delwel, Fles, Daams, Weening, Sonnenberg: "The A and B variants of the alpha 3 integrin subunit: tissue distribution and functional characterization." in: Laboratory investigation; a journal of technical methods and pathology, Vol. 76, Issue 4, pp. 547-63, (1997) (PubMed).

Antigendetails

Target: Integrin alpha 3B, alpha 6B

Andere Bezeichnung: Integrin alpha 3B+alpha 6B

Hintergrund: Integrins are a family of heterodimeric membrane glycoproteins consisting of non-covalently associated alpha and beta subunits. More than 18 alpha and 8 beta subunits with numerous splice variant isoforms have been identified in mammals. In general, integrins function as receptors for extracellular matrix proteins. Certain integrins can also bind to soluble ligands or to counter-receptors on adjacent cells, such as the intracellular adhesion molecules (ICAMs), resulting in aggregation of cells. Signals transduced by integrins play a role in many biological processes, including cell growth, differentiation, migration and apoptosis. For integrin subunits alpha3 and alpha6, two cytoplasmic variants, A and B, have been identified.