STIP1 Antikörper (C-Term)

Produktnummer ABIN3044551

Produktdetails anti-STIP1 Antikörper

Target: STIP1 (Stress-Induced-phosphoprotein 1 (STIP1))

Bindungsspezifität: AA 505-543, C-Term

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser STIP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Stress-induced-phosphoprotein 1(STIP1) detection. Tested with WB in Human,Rat.

Sequenz: RLILEQMQKD PQALSEHLKN PVIAQKIQKL MDVGLIAIR

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Stress-induced-phosphoprotein 1(STIP1) detection. Tested with WB in Human,Rat.
Gene Name: stress induced phosphoprotein 1
Protein Name: Stress-induced-phosphoprotein 1

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human STIP1 (505-543aa RLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLIAIR), identical to the related mouse and rat sequences.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu STIP1

Target: STIP1 (Stress-Induced-phosphoprotein 1 (STIP1))

Andere Bezeichnung: STIP1 (STIP1 Produkte)

Synonyme: HOP antikoerper, IEF-SSP-3521 antikoerper, P60 antikoerper, STI1 antikoerper, STI1L antikoerper, Hop antikoerper, Sti1 antikoerper, p60 antikoerper, MGC53256 antikoerper, stip1 antikoerper, MGC76181 antikoerper, MGC82554 antikoerper, zgc:92133 antikoerper, stress induced phosphoprotein 1 antikoerper, stress-induced phosphoprotein 1 antikoerper, stress induced phosphoprotein 1 L homeolog antikoerper, Stress-induced-phosphoprotein 1 antikoerper, stress-induced-phosphoprotein 1 antikoerper, stress induced phosphoprotein 1 S homeolog antikoerper, STIP1 antikoerper, Stip1 antikoerper, stip1.L antikoerper, GL50803_27310 antikoerper, PGTG_06468 antikoerper, stip1 antikoerper, stip1.S antikoerper

Hintergrund: STIP1 is an adaptor protein that coordinates the functions of HSP70 and HSP90 in protein folding. It is thought to assist in the transfer of proteins from HSP70 to HSP90 by binding both HSP90 and substrate-bound HSP70. STIP1 also stimulates the ATPase activity of HSP70 and inhibits the ATPase activity of HSP90, suggesting that it regulates both the conformations and ATPase cycles of these chaperones. The International Radiation Hybrid Mapping Consortium mapped the STIP1 gene to 11q13.

Synonyms: Epididymis secretory sperm binding protein Li 94n antibody|HEL S 94n antibody|Hop antibody|Hsc70/Hsp90 organizing protein antibody| Hsc70/Hsp90-organizing protein antibody|IEF SSP 3521 antibody|NY REN 11 antigen antibody|P60 antibody|Renal carcinoma antigen NY-REN-11 antibody|STI1 antibody|STI1L antibody|STIP1 antibody|STIP1_HUMAN antibody|Stress induced phosphoprotein 1 antibody|Stress-induced-phosphoprotein 1 antibody|Transformation sensitive protein IEF SSP 3521 antibody|Transformation-sensitive protein IEF SSP 3521 antibody

Gen-ID: 10963

UniProt: P31948