OTX2 Antikörper (C-Term)

Produktnummer ABIN3043586

Produktdetails anti-OTX2 Antikörper

Target: OTX2 (Orthodenticle Homeobox 2 (OTX2))

Bindungsspezifität: AA 258-289, C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser OTX2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for Homeobox protein OTX2(OTX2) detection. Tested with WB in Human.

Sequenz: DYKDQTASWK LNFNADCLDY KDQTSSWKFQ VL

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Homeobox protein OTX2(OTX2) detection. Tested with WB in Human.
Gene Name: orthodenticle homeobox 2
Protein Name: Homeobox protein OTX2

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Otx2 (258-289aa DYKDQTASWKLNFNADCLDYKDQTSSWKFQVL), identical to the related mouse sequence.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, The detection limit for Otx2 is approximately 0.1 ng/lane under reducing conditions.
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu OTX2

Target: OTX2 (Orthodenticle Homeobox 2 (OTX2))

Andere Bezeichnung: OTX2 (OTX2 Produkte)

Synonyme: CPHD6 antikoerper, MCOPS5 antikoerper, E130306E05Rik antikoerper, id:ibd2915 antikoerper, zOtx2 antikoerper, zgc:136535 antikoerper, zotx-2 antikoerper, Xotx-2 antikoerper, Xotx2 antikoerper, otx-2 antikoerper, otx2 antikoerper, orthodenticle homeobox 2 antikoerper, orthodenticle homeobox 2 S homeolog antikoerper, orthodenticle homeobox 2 L homeolog antikoerper, OTX2 antikoerper, Otx2 antikoerper, otx2 antikoerper, otx2.S antikoerper, otx2.L antikoerper

Hintergrund: OTX2 is also known as CPHD6 or MCOPS5. This gene encodes a member of the bicoid subfamily of homeodomain-containing transcription factors. The encoded protein acts as a transcription factor and plays a role in brain, craniofacial, and sensory organ development. The encoded protein also influences the proliferation and differentiation of dopaminergic neuronal progenitor cells during mitosis. Mutations in this gene cause syndromic microphthalmia 5 (MCOPS5) and combined pituitary hormone deficiency 6 (CPHD6). This gene is also suspected of having an oncogenic role in medulloblastoma. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Pseudogenes of this gene are known to exist on chromosomes two and nine.

Synonyms: CPHD6 antibody|Homeobox protein OTX2 antibody|MCOPS 5 antibody|MCOPS5 antibody|MGC45000 antibody|Orthodenticle 2 antibody|Orthodenticle homeobox 2 antibody|Orthodenticle homolog 2 (Drosophila) antibody|Orthodenticle homolog 2 antibody|Orthodenticle2 antibody|Otx 2 antibody|otx2 antibody|OTX2_HUMAN antibody

Gen-ID: 5015

UniProt: P32243

Pathways: Dopaminergic Neurogenesis