Arc Antikörper (C-Term)

Produktnummer ABIN3043525

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch Arc in WB. Er zeigt eine Reaktivität gegenüber Human, Ratte und Maus.

Kurzübersicht für Arc Antikörper (C-Term) (ABIN3043525)

Target: Arc (Activity-Regulated Cytoskeleton-Associated Protein (Arc))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Arc Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Arc Antikörper

Bindungsspezifität: AA 332-366, C-Term

Verwendungszweck: Rabbit IgG polyclonal antibody for Activity-regulated cytoskeleton-associated protein(ARC) detection. Tested with WB in Human,Mouse,Rat.

Sequenz: KLKRFLRHPL PKTLEQLIQR GMEVQDDLEQ AAEPA

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for Activity-regulated cytoskeleton-associated protein(ARC) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: activity-regulated cytoskeleton-associated protein
Protein Name: Activity-regulated cytoskeleton-associated protein

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Arc (332-366aa KLKRFLRHPLPKTLEQLIQRGMEVQDDLEQAAEPA), different from the related mouse sequence by two amino acids, and from the related rat sequence by three amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu Arc

Target: Arc (Activity-Regulated Cytoskeleton-Associated Protein (Arc))

Andere Bezeichnung: ARC

Hintergrund: ARC, officially called activity-regulated cytoskeleton-associated protein, is a plasticity protein first characterized in 1995. It is a member of the immediate-early gene (IEG) family. The ARC gene is mapped to chromosome 8q24. It has got 460 amino acid protein which shares significant similarity with rat Arc. The Arc is highly expressed in heart, brain, lung, skeletal muscle, pancreas, prostate and testis and has got weak expression in small intestine, colon, and peripheral blood leukocytes. Arc is widely considered to be an important protein in neurobiology and also a significant tool for systems neuroscience.

Synonyms: activity regulated cytoskeleton associated protein antibody|activity regulated gene 3.1 protein homolog antibody|Activity-regulated cytoskeleton-associated protein antibody|Activity-regulated gene 3.1 protein homolog antibody|Arc antibody|ARC/ARG3.1 antibody| ARC_HUMAN antibody|Arg3.1 antibody

Gen-ID: 23237