POR Antikörper (C-Term)

Produktnummer ABIN3043443

Produktdetails anti-POR Antikörper

Target: POR (P450 (Cytochrome) Oxidoreductase (POR))

Bindungsspezifität: AA 633-668, C-Term

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser POR Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Verwendungszweck: Rabbit IgG polyclonal antibody for NADPH--cytochrome P450 reductase(POR) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Sequenz: RNMARDVQNT FYDIVAELGA MEHAQAVDYI KKLMTK

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for NADPH--cytochrome P450 reductase(POR) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: P450 (cytochrome) oxidoreductase
Protein Name: NADPH--cytochrome P450 reductase

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human POR (633-668aa RNMARDVQNTFYDIVAELGAMEHAQAVDYIKKLMTK), different from the related mouse and rat sequences by five amino acids.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu POR

Target: POR (P450 (Cytochrome) Oxidoreductase (POR))

Andere Bezeichnung: POR (POR Produkte)

Synonyme: CPR antikoerper, CYPOR antikoerper, P450R antikoerper, POR antikoerper, CCR antikoerper, CG11567 antikoerper, DMR antikoerper, DmCPR antikoerper, Dmel\\CG11567 antikoerper, NCPR antikoerper, P450 antikoerper, cpr antikoerper, zgc:110032 antikoerper, npr antikoerper, xpor antikoerper, 4933424M13Rik antikoerper, PORCINO antikoerper, T5J17.90 antikoerper, T5J17_90 antikoerper, TFC C antikoerper, TUBULIN-FOLDING COFACTOR C antikoerper, cytochrome p450 oxidoreductase antikoerper, P450 (cytochrome) oxidoreductase antikoerper, ADP-ribosylation factor interacting protein 2 antikoerper, Cytochrome P450 reductase antikoerper, P450 (cytochrome) oxidoreductase a antikoerper, P450 (cytochrome) oxidoreductase L homeolog antikoerper, NADPH--cytochrome P450 reductase antikoerper, C-CAP/cofactor C-like domain-containing protein antikoerper, POR antikoerper, Arfip2 antikoerper, Por antikoerper, Cpr antikoerper, pora antikoerper, por.L antikoerper, LOC100406157 antikoerper, por antikoerper, LOC100619047 antikoerper

Hintergrund: POR is a membrane-boundenzyme required for electron transfer from NADPH to cytochrome P450 in the endoplasmic reticulum of theeukaryotic cell. The gene encodes an endoplasmic reticulum membrane oxidoreductase with an FAD-binding domain and a flavodoxin-like domain. The protein binds two cofactors, FAD and FMN, which allow it to donate electrons directly from NADPH to all microsomal P450 enzymes. Mutations in this gene have been associated with various diseases, including apparent combined P450C17 and P450C21 deficiency, amenorrhea and disordered steroidogenesis, congenital adrenal hyperplasia and Antley-Bixler syndrome.

Synonyms: CPR antibody|CYPOR antibody|DKFZp686G04235 antibody|FLJ26468 antibody|NADPH Cytochrome P450 Reductase antibody|NADPH dependent cytochrome P450 reductase antibody|NADPH--cytochrome P450 reductase antibody|NCPR_HUMAN antibody|P450 (cytochrome) oxidoreductase antibody|P450 Cytochrome Oxidoreductase antibody|P450R antibody|POR antibody

Gen-ID: 5447

UniProt: P16435

Pathways: Regulation of Hormone Metabolic Process, Regulation of Hormone Biosynthetic Process, SARS-CoV-2 Protein Interaktom