Phospholamban Antikörper (N-Term)
-
- Target Alle Phospholamban (PLN) Antikörper anzeigen
- Phospholamban (PLN)
-
Bindungsspezifität
- AA 1-35, N-Term
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Phospholamban Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Cardiac phospholamban(PLN) detection. Tested with WB in Human,Mouse,Rat.
- Sequenz
- MEKVQYLTRS AIRRASTIEM PQQARQKLQN LFINF
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Cardiac phospholamban(PLN) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: phospholamban
Protein Name: Cardiac phospholamban - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human PLN(1-35aa MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINF), different from the related mouse and rat sequences by one amino acid.
- Isotyp
- IgG
- Top Product
- Discover our top product PLN Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat, The detection limit for PLN is approximately 0.1 ng/lane under reducing conditions.
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- Phospholamban (PLN)
- Andere Bezeichnung
- PLN (PLN Produkte)
- Synonyme
- LOC100226261 antikoerper, plb antikoerper, cmd1p antikoerper, CMD1P antikoerper, CMH18 antikoerper, PLB antikoerper, Plb antikoerper, Plm antikoerper, phospholamban antikoerper, PLN antikoerper, pln antikoerper, Pln antikoerper
- Hintergrund
-
Phospholamban is a 52 amino acid integral membrane protein that regulates the Ca2+ pump in cardiac muscle and skeletal muscle cells. The subsequent activation of the Ca(2+) pump leads to enhanced muscle relaxation rates, thereby contributing to the inotropic response elicited in heart by beta-agonists. Phospholamban is also expressed in slow-twitch skeletal muscle and some smooth muscle cells. It is observed that human ventricle and quadriceps displayed high levels of phospholamban transcripts and proteins, with markedly lower expression observed in smooth muscles, while the right atrium also expressed low levels of phospholamban. The structure of the human phospholamban gene closely resembles that reported for chicken, rabbit, rat, and mouse. Comparison of the human to other mammalian phospholamban genes indicated a marked conservation of sequence for at least 217 bp upstream of the transcription start site.
Synonyms: Cardiac phospholamban antibody|CMD1P antibody|CMH18 antibody|PLB antibody|PLN antibody|PPLA_HUMAN antibody - Gen-ID
- 5350
- UniProt
- P26678
- Pathways
- Negative Regulation of Transporter Activity
-